Q. Why are some of our prayers not answered? How to know if a Jnani is genuine? | Sri Ramana Maharshi | Aham Sphurana

The excerpt below is taken from the text Aham Sphurana (see here to find out more about this text and download a copy for free), 20th July 1936:

Questioner: It happens to some that they pray – in all good faith – to God, yet their prayers are unequivocally repudiated. What is the reason?

Bhagavan Sri Ramana Maharshi: Can you be trusted to know what is best for you?

Q.: I should hope so.

B.: That is your opinion.

Q.: What then is Sri Bhagawan’s opinion?

B.: ‘O Lord, thou hast searched me, and known me. Thou knowest my downsitting and mine uprising, thou understandest my thought afar off. Thou compassest my path and my lying down, and art acquainted with all my ways.’

Q.: The implication being?

B.: He knows what is best for you; you do not. Therefore unconditionally surrender yourself to him and leave your fate in his hands. That is the only thing to be done. Prayer is merely a lower form of surrender. It is highly prone to failure, because if what is asked does not aid Realisation, it may not be granted, even though you may be thinking that what you are asking is going to [serve as an] aid in Realisation. Or, your karma may not permit the request to be granted.

Q.: Spiritually-inclined people pray for strength to inrovert the mind. Or, they pray for Self-Realisation. How can that be not an aid in Realisation?

B.: Because it posits the dangerous notion that there exists an [individual] “I” who craves for himself the state called Realisation. Such prayers are unnecessary. Maam Aekam Sharanam Vraja. ‘Only surrender to Me.’

Q.: Why does God allow karma to meddle with even the efforts of sincere aspirants who are trying to Realise?

B.: The arrangement of karma – [for karma itself is] unavoidable – is actually adroitly done in such a way as to give the sadhaka the maximum possible chance of completely cleansing the mind of all vritts. So, if you are destined to Realise in this lifetime, rest assured that your karma has been ingeniously arranged in such a manner as to inevitably take you to the Goal.

Q.: And if I am destined otherwise?

B.: Perhaps you would not be here today.

Q.: The same astute God who manipulates karma so carefully – why was he not careful enough to safeguard the Self from slipping into the bondage of ignorance?

B.: Does the Self complain of having thus fallen?

Q.: No. But I do.

B.: Are you apart from the Self?

Q.: The mahavakyas state that I am supposed to be one with Brahman.

B.: And your Experience is in Corroboration?

Q.: Alas! No. All I feel is the miserable ego.

B.: Yes. Misery is one with the ego. Kill the ego.

Q.: It seems to be an impossible accomplishment even for those with decades of systematic training in the spiritual field.

B.: There is no accomplishment possible. What is intimate and inherent cannot be accquired. The only thing to do is destroy the useless accreations that cause all the nuisance. We are not trying to attain anything. On the other hand, we are trying to give up everything.

Q.: Should I not try to attain Realisation of the Self?

B.: No. Give up everything. Only the Self remains.

Q.: It sounds simple enough. Yet, only one in a million men manage to reach this supreme state, according to Sri Krishna. Does it mean that, at any given point of time in the world, the number of Jnanis living should be a precise 0.0001% of the total population?

B.: [laughing] Possibly!

Q.: In my view even this seems an outlandish estimate. Are there now circa 269 Jnanis living in India, then, regard having been had to the numbers available by the 1931 Census?

B.: [somewhat mordaciously but without deviating from his good cheer] Why not? Do you suppose all Jnanis are unfortunate enough to be put in a cage like this, and put up for ‘public examination’? [in English:] Ladies and gentlemen, presenting… THE FREAK SHOW! Exhibit No. 1 – Sharji, the Venus of the Hottentots! Exhibit No. 2 – Elephant-man Merrick! Exhibit No. 3 – The ‘Bhagawan’, Ramana! அ என்ன பாழாகப் ேபான பகவானே◌ா [Tom: What a waste, O Lord] . No. Only those whose prarabdha is destined to be exceedingly miserable suffer like this! Sri Gandhiji has written, ‘The woes of Mahatmas are known to Mahatmas alone.’ [laughs heartily]

Q.: Other Jnanis, who, according to Bhagavan, enjoy a better prarabdha – they would be meditating in solitary places such as inaccesible jungles and caves, well away from habitable zones of humanity, I presume…

B.: You may presume whatever you like, no doubt…

Q.: So I am wrong?

B.: It all varies according to prarabdha. The Jnani is unfazed by what happens to the body. He has nothing to do with it. He has no localised consciousness functioning from within it. Killing it cannot harm him. Torturing it cannot affect him. He is absorbed by the Beyond, and quite lost there – for good. He may have 4 wives and 32 children. He may be running a busy household with dozens of mouths to feed. He may be employed on both day and night shifts of duty. Or, again, he may be sitting in an inaccesible cave with sensory organs in an inactive state, body rotting. It may be either way, but all this can be only from the point of view of the onlooker, since action is altogether alien to the Jnani; he himself knows nothing, sees nothing, does nothing. He has quite perished. Only a Jnani can tell who is a Jnani.

A person might look like a simpleton, yet he might know himself as the immortal Self. Another may display an unending spout of vedantic learning, yet his mind may not in the least have subsided. In this topsy-turvy world, which must needs always judge by its usual yardstick of ‘doing’, it is the latter who is generally extolled as the genuine case. The result? Misery for all involved. People cheat themselves into believing that they are in the vicinity of a great Mahatma. The pretender eventually himself foolishly comes to believe that he must indeed be a great Jnani, since so many people praise him day and night. So his ego becomes bloated; as a consequence he lands himself in all sorts of unpleasant situations. So, display of vedantic learning may cause a great very many problems for all involved. It is best to keep quiet.

Q.: Bhagavan said a Jnani may have numerous wives. Polygamy is a sin as per Hindu dharma. Can a Jnani sin, then? As far as my knowledge goes, the Manusmriti allows taking the next wife only if the existing wife or wives are mentally ill, infecundous, or unable to participate in rituals for the departed ancestors.

B.: What the Jnani does is always right. This does not mean that a man is morally excused in pretending to be a Jnani and then conveniently committing all sorts of crimes.

Q.: But how to tell who is a genuine Jnani?

B.: Only by yourself becoming lost in Jnana. However, there is one exceedingly rare exception. If a particular Jnani is destined to be your Jnanaguru, when you meet him there is an inexplicable mutual outpouring of ecstatic Love. The Love mentioned here is not consummated by any physical act. It is consummated only by surrendering to the object of such Love. The Jnani himself never loves or hates; only, when he meets one who is destined to be placed in his ultimate care, he directs his attention toward that person. It is not volitionary, but rather Automatic Divine Activity. There is nothing in him left to choose. Unto one who has the pakkuvam [Tom: ripeness], the Grace or Love begins to flow of its own accord. The Jnana-guru might not look at the mature devotee or exchange words with him, yet, one who is Ready feels the irresistible onslaught of inevitable rapid mental introversion in the form of blissful divine Love. This way you can tell that the person in whose presence you have such experience, is your Jnana-guru. Again, this might not happen in the case of all aspirants.

Q.: I have so far not had any such novel experiences with Bhagavan. Can I still Realise in this lifetime?

B.: All will turn out Right in the end.

Q.: Sometimes Bhagavan does not look at visitors. He does not respond to their queries. Does he refuse them his impartial Grace?

B.: Have you seen how they seperate chaff from the Grain here? They pour the seeds on the றம◌் , and then trenchantly shake it in a speedious upand-down motion. Can you guess the scientific principle underlying the act?

Q.: What is worthless and light in weight is blown away by the wind. What is precious and heavy is not affected by the movement. Yes, it is clear now.

B.: நல்லத◌ ! [Tom: good]

Q.: One imagines things and enjoys them by virtue of his strength of imagination. It is said that gross manifestations of such mental creations are possible for Brahma the Creator. Should the same power not be available with His creation, man?

B.: That is your opinion.

B.: J.K. says that man should try to find out the ‘I’. Then ‘I’ dissolves away, being only a bundle of circumstances. There is nothing assertible behind the ‘I’. His teaching seems to be very much like the Buddha’s.

B.: Yes. The truth is well beyond possibility of conceptual expression or explanation. It is pure Experience only, for there is no experiencer. When you finally do reach the Self, you will be shocked to discover that you have been foolishly searching frantically for something that was always right in front of your nose – no, even closer, for the nose and the object in front of it must be seen with the eye to ascertain their apparent existence, whereas the Self requires no perception to support its actual existence. The Self is pratyakshasakshathswayamprakasha-swaroopam. Everything shines in and by its light, but it knows nothing but itself. It shines by its own light alone. The lusturous beauty of it never fades. It is truly immutable, indestructible and imperishable. One who loses himself in it has no more cares or worries. It is the one true goal of man’s life, yet it is here and now. That is the great mystery.

Humility, Vulnerability, Surrender and GRACE | Holy Bhagavan Sri Ramana, the Self Within! Bhakti, poetry

by Tom Das

(Please see if the following is helpful for you…)

Total and utter humility and total self-honesty are keys to liberation:
Realise how fragile you are, how little you really know, and how vulnerable you are to suffering.

Your beliefs, your ego, your defences, your conceit and your thought patterns convince you that you will be safe, that you can weather the storm…but admit the truth! That you are totally helpless and totally vulnerable to immense suffering and calamity. Admit it.

At any moment you are liable to crack open, break down and become a nervous wreck. Be truthful with yourself – admit it.

So…

Instead…

Be small, be vulnerable, be humble…

And then you can,
With tears of pining despair flowing,
Admit how much you want to be with HIM,
SAFE IN HIS ARMS:

Take refuge in HIM
– only in HIM are you safe:
Withdraw from the many objects into the SUBJECT,
HIM,
– ‘Out there it is unsafe’…

Therefore,
Timid, vulnerable, cowing,
Withdraw within,
Fearful and quivering,
TAKE REFUGE in HIS PRESENCE
Wherein he will cleanse you and MAKE YOU WHOLE.

Guru Bhavagan Sri Ramana has told us:

“O heart of mine, it is not wise to stay out.
Safe it is to stay within. Conceal yourself from maya
Which plans to draw you out to destroy you.
Stay within.”
(Guru Vachaka Kovai verse 187)

and

“For those who ever think of and cling to the Feet of
the Sadguru, who is the blazing flame of pure Jnana,
through the Grace obtained by such Guru-bhakti, their
minds will become clear and they will achieve Mei-
Jnana [True Knowledge].”
(Guru Vachaka Kovai verse 305)

Abide with HIM, the SELF within,
Immerse yourself in HIS GRACE,
Drown and anihilate your ego-self, the SOLUTE
in HIM, the DIVINE SOLVENT.

As Guru Bhavagan Sri Ramana has told us:

“Worship of [ie. surrender to] the Feet of the Guru,
with Guru-bhakti, is the real mantra, which will
destroy all the rising vasanas and bestow Jnana,

in which there will be no fear of Maya’s delusion.
Thus should you know.”
(Guru Vachaka Kovai verse 306)

You – the ego – who are the source of all suffering and pain,
DISSOLVE YOURSELF in HIM
So that ONLY HIS RADIANT PRESENCE remains

Abiding silently as SELF WITHIN
is to BE WITH HIM
-This is the highest WORSHIP OF HIM

As Bhagavan Sri Ramana says:

Extinguishing the triple fire,
The Guru’s Feet have given us shelter.
To abide there and control the mind
From craving for the world of sense
Is worship of those Flowery Feet.
(Guru Vachaka Kovai verse 318)

Do NOT allow the world to take you away from him
Do NOT allow the world to prevent you from BEING WITH HIM
Do NOT allow the world to prevent you from BEING IN HIS BLISSFULL EMBRACE
Do NOT allow the world to prevent you from WORSHIPPING HIM EVERY SPARE SECOND YOU HAVE

Do NOT allow your thoughts to take you away from HIM
Do NOT allow your thoughts to prevent you from WORSHIPPING HIM IN SILENT BLISS
Do NOT allow your thoughts to stop you WITHDRAWING INTO YOURSELF and taking HIM AS REFUGE

Tell yourself:
I will NOT allow the world to take me away from HIM
I will NOT allow my thoughts to take me away from HIM
I will NOT allow the mind and world to take me away from MY WORSHIP OF HIM,
MY BEAUTIFUL REFUGE WITHIN

BE WITH HIM
Be in his PRESESNCE
BE STILL
and
BE WITH HIM

DISSOLVE YOURSELF IN HIM
So ONLY HE,
The Residue,
Remains.

Tell yourself:
I will allow myself to DISSOLVE IN HIM until ONLY HE REMAINS

Holy Mount Arunachala,
The FORM OF THE SELF,
Holy BHAGAVAN SRI RAMANA,
The FORM OF THE SELF,

May I gaze upon thy form,
outwardly and inwardly,
May I take refuge in thee,
May I entrust myself to your BLISSFULL EMBRACE,
WITHIN
And become one with YOU
Destroying myself
Discovering myself
So that only YOU remain

As Maha Guru Sri Bhagavan says:

“By coming near to the Sadguru
and by depending completely upon His Grace,
with great Guru bhakti,
one will have no misery in this world

and will live like Indra.”
(Guru Vachaka Kovai verse 324)

!Om Namo Bhagavate Sri Arunachala Ramanaya Om!
!Om Namo Bhagavate Sri Arunachala Ramanaya Om!
!Om Namo Bhagavate Sri Arunachala Ramanaya Om!

I bow down to my Own True Self! | Yoga Vasistha

Here is a prayer or salutation that was read out by someone at Satsang this Thursday. It is taken from the wonderful text Yoga Vasistha, where it is referred to as a prayer:

Salutations to that reality in which all the elements, and all the animate and inanimate beings shine as if they have an independent existence, and in which they exist for a time and into which they merge.

Salutations to that consciousness which is the source of the apparently distinct threefold divisions of knower, knowledge and known, seer, sight and seen, doer, doing and deed.

Salutations to that bliss absolute (the ocean of bliss) which is the life of all beings whose happiness and unfoldment is derived from the shower of spray from that ocean of bliss.

~Vasistha’s Yoga (translated by Swami Venkatesananda)

As you can see, the prayer is naturally divided into three sections, with each one corresponding to Sat-Chit-Ananda (Reality-Consciousness-Bliss), which refers to the Self, ie. what we truly are, or Brahman, the Divine Absolute. So this is really a prayer to God, Brahman, or a Prayer to Ourself:

I bow down and worship my Own True Self!

Bow, bow deeply

Bow to life,
Bow deeply,
Feel gratitude for the gifts God gives us,
And everything that comes our way
Is a gift from Him

Bow deeply,
And fall in love,
Fall in love with Life,
Allow Her to take you,
Overwhelm you,
And show you Her treasures.
Allow life to make you whole,
Make you clean,
Clean from outside through to within.

Bow deeply,
Bow to life,
Gratitude pouring in,
Taking you over,
One with Him,
Cleasing you,
Purging you of negativity
Ridding you of illusion,
as Love takes over.

Now Love takes over,
It compels you to bow,
And delights you,
Moves you this way and that,
A willing servitude,
All a gift,
Flowing with gratitude,
Flowing with bliss,
So thankful,
Only Her.

Now where are you?
Where are you to be found?
At first you were the lover
-that (subject) which was loving,
But now, where are you?
Where have you gone?
Where is the lover?
Where is the loved?

The distinctions have been lost:

We were once thrown and tossed by the oceans,
This way and that,
But now there is only Ocean,
Throwing Ocean,
This way and that.

We were once the Lover,
Loving God,
Loving life,
But now there is only Him,
Loving Himself,
Playing, toying,
And Still and Unmoving,
Only love.

How can I bow to Him,
When there is no me,
and no Him?
How can I love life,
when there is no love,
and no life?
Only Him,
Only Life,
Only Love.

Yet still
I bow deeply

Q. What is the best spiritual practice for a busy mind?

Q. What is the best spiritual practice for a busy mind?

Tom: I don’t know exactly which practice is right for you. That is for you to find out.

What do you feel drawn to?

As we have already spoken about this before, the main thing for you is that you try something for a significant amount of time to see if it has a beneficial effect before dismissing it.

For an especially busy mind I would recommend trying physical exercise, singing, dancing, chanting a mantra, praying and devotion to God/something.

Also stay away from TV/media and adopt a diet that is as plant-based as possible.

These are all suggestions, not directives.

This allows the mind’s positive and negative energies to balance and for peace to arise, which in turn facilitates stillness and deep insight.

Poetry: the vision of the Highest

 

Vishnu standing.jpg

If it feels right for you:

Keep your mind on the vision of The Highest,
Fix your mind on
that which is Most Holy,
that which is Resplendent in its Perfection,
that which is Total Grace,
Total Bliss and Love,
that which is Immutable,
Unhanging,
Untouchable,
Immovable,
Ever-present,
And that which does nothing,
But through which all things are done,
And in which all things reside.

I invoke your presence,
Through uttering your Holy Name,
Through thinking of your transcendental form,
Through bowing and prostrating again and again and again,
Through prayer and gratitude and chanting songs of your greatness,
Through allowing your Love and Light to fill me up.

You are that which giveth and taketh away,
You are the wish-fulfilling tree,
You are the remover of all sins,
O ever-mercifull Lord!
You are non-seperate from me,
No different to Me in Essence,
Inherently pure,
Always in my Heart.

All is already nothing but Your Will,
All movements are nothing but your expression of Lila,
the Grand Play of the Divine made Manifest.

I bow to You,
The Highest,
Most Holy:
My heart weeps cleansing tears of pain and joy at the mere thought of Your Name and Form.

Om Namo Bhagavate Vasudevaya Namah Om
(Om, I bow to you, my Beloved, Lord of Life and Light in all Beings, I bow to you, Om)

How do I deal with craving sense pleasures and neglect of spiritual practice?

unplug

 

Q: What would you say to someone (me) who persistently or often craves and desires so that remembrance of the Self seems to get neglected for spells, like it is sometimes a second priority? Presumably it is good to analyse the desire and see that the pleasure from it cannot be lasting and suffering from not always getting the desire is inevitable and see that there is a greater happiness in the absence of craving?

Tom: What does your heart say?

Q: That I neglect my heart feeling  because I look to the Self as being outside the body embedded as oneness in the appearance of the world outside. I have actually just been watching your video with Roger Castillo where you talk about the yogic practise of abiding in the I AM . I used to be a lot more devotional early on in my seeking, now I feel I neglect that aspect, thanks Tom.

Tom: Be with your heart ❤ Don’t neglect the powerful devotional instinct if it moves you. Fall flat on your front and prostrate yourself if need be. Pour out your heart and soul in prayer, if moved to. Weep and worship, if called. And let me know how you’re doing ❤🙏❤ Many thanks for your questions 🙏

Allow My Bliss to fill you up

God is Love
Know Me as That which resides in your heart,
Know Me as the Source of all Bliss:
-Meditate on Me,
-Love Me,
-Be with Me.

I will straighten you out,
Heal you,
Make you whole;

I will descend into you,
and pervading your body,
I will fill you with light, warmth and love,
Thus replenishing you from within,
Inside to out.

Do not extend the tentacles of your desire
outwards towards wordly things,
But come to Me
Within your heart.

Rest within,
Surrendering unto Me,
Allow My Bliss to fill you up.

Over and over again,
Allow My Bliss to fill you up.