Ramana Maharshi: Q. Is Hitler really a divine instrument in God’s hands? Why does Bhagavan wear no clothes? Occult powers, Milarepa | Aham Sphurana

The following is taken from Aham Sphurana 19th July 1936

A convivial, middle-aged Caucasian asked –
Questioner: I understand that according to Bhagavan, Reality refers to consciousness unsullied by thought.

Bhagavan Sri Ramana Maharshi: What you comprehend, or think you are able to apprehend, can never be Reality. That suble space in which this fleeting you, as you are now falsely imagining yourself to be, ceases to exist, so exposing the actual, permanent you lying underneath as true Being, is Reality.

Q.: It is said that this mountain Arunachala posseses a powerful spiritual energy. If I carry away rocks from the mountain back home, will the mountain’s power accompany me? From which portion of the Hill should rocks be gathered for maximum beneficious effect?

B.: Is there any use in going on rock-hunting expeditions? The contumacious [Tom: stubborn and disobedient] mind must be introverted and destroyed. That [regaining the natural state of Self] is the only worthwhile thing to do in life.

Q.: I am interested in experimenting with alternate forms of medicine. What is Bhagavan’s opinion on Hahnemann’s system of ‘Like-cures-like.’? How can diluting a substance make its effect upon the patient more potent?

B.: [no answer]

Q.: What is Bhagavan’s opinion on the present German Chancellor? Today morning I met a Brahmin in this place, who confidently asserts that he is a divine incarnation, or a servile instrument in God’s hands, meant to ruthlessly put down injustice wherever it occurs in the world, commencing from Germany. Is deployment of violence justified to root out injustice? Does not Mr. Gandhi advocate –

At that moment, an excited voice, in strained English, suddenly announced into the air from the back of the Hall –

‘I am convinced that Sri Hitler and Sri Bhagawan are in the same supreme state of Brahmajnana [Tom: Brahman-knowledge, ie. self-knowledge]. But perhaps Hitler may be a Brahma-rakshasha [Tom: an evil spirit arisen from a sinful or fallen Brahmin].Nevertheless he is also a Jnani, nothing inferior to that… Has not his deputy said, “Do not seek Hitler with the mind. It is through the Heart that you shall succeed in finding Him.”? Is this not Bhagawan’s teaching verbatim, when people question Him about finding God? Hitler may use violent methods because it is his ordained style of functioning. Nonetheless, He is an avatar. I know… Consider his inspiring words – “It is a necessity of human evolution that the individual should be imbued with the spirit of sacrifice in favour of the common weal, and that he should not be influenced by the morbid notions of those knaves who pretend to know better than Nature and who have the impudence to criticize her decrees.”, “The Strong is Mightiest Alone.”, “Man has become great through perpetual struggle. In perpetual peace his greatness must decline.”, “He who would live must fight. He who does not wish to fight in this world, where perpetual struggle is the only permanent law of life, has not the right to exist.”, “The sledgehammer of fate which strikes down the one so easily suddenly finds the counter-impact of Steel when it strikes at the other.”, and many more. Are these not the words of a Jnani? Is it not self-evident that it must be so? If Bhagavan will give permission I want to read out more, so that everyone can be benifitted by these holy words uttered by a great Jnani.’

There was no response from Bhagavan. The brahmin retreated into silence.

Q.: Yes, this is the man. What is to be made out of his outlandish claims? Is Herr Hitler really a divine instrument in God’s hands?

B.: நாம் எல்ேலாேம அவரால் ஆட்ைவக்கப்பட்ட ைகப்பாைவகள் தாேன. [All sentient beings are verily divine instruments in the hands of the Supreme Lord {Parameshwara}.]

Q.: Sri Bhagawan wears only underwear. I hear, whilst living in the Hill, He was totally nude. What is the philosophy behind it? Is it aversion to luxury? Will being nude help in Realising the Self?

B.: Mental nudity is the way to the Self.

Q.: And what is that?

B.: Mind denuded of vrittis.

Q.: What is a vritti?

B.: A strand of modification in and of pure consciousness.

Q.: Still, what is the reason Bhagavan won’t wear any clothes?

B.: Have you come all the way from the New World only to ask this question?

Q.: It is said that the Jnani never sleeps. Is it true? Do you never sleep?

B.: On the other hand, I am always asleep. I have permanently put myself to Eternal Sleep from which no waking could ever be possible.

Q.: Bhagavan is now talking to me. How can he be asleep? Is he talking in his sleep, then?

B.: Yes.

Q.: I am beginning to guess there is a hidden layer of meaning in all your answers…

B.: The Jnani’s mind is asleep in Brahman. It is awake to Brahman but unaware of anything else – rather, there is no ‘anything else’ for him, apart from Brahman, to be aware of. “I” am not talking to “you”; these [are appearances that] are inseperable from Brahman. Their substratum or vasthu [Tom: truth or reality] is Brahman only. There cannot be a not-Brahman. What IS, is only Brahman. What IS NOT, cannot BE. Thus the import of Sri Krishna’s wisely enunciated words: Nasatho vidyathey bhavo nabhavo vidyathey sathaha [Tom: ‘Of the unreal, there is no being; of the Real, there is no non-being…’ This is the first section of Bhagavad Gita verse 16.2]

Q.: The yogi smears his body all over with ash from the crematorium. What is the purpose?

B.: To remember: ‘One day I shall likewise be reduced into ash.’

Q.: Why keep on reflecting upon such a macabre truth?

B.: To get rid of the idea, ‘I am this body.’; so long as such an idea, or any other vritti, remains, Realisation cannot be had, even in dreams.

Q.: How, and why, did the Absolute Self or ‘the Brahman’ fall from his high state of Godhood, and become the mind?

B.: He never fell.

Q.: What then is to account for the existence of the mind?

B.: Its own ignorance.

Q.: How did that ignorance arise?

B.: On the false strength of the one who meaninglessly asserts, ‘I am ignorant.’.

Q.: If the assertion ‘I am ignorant.’ is wrong, all are then Jnanis.

B.: Quite so.

Q.: I am also a Jnani like Bhagavan, then? Am I not a mere mortal?

B.: In fact, all are only Jnanis – at least in my vision it is so. One who feels otherwise should ask himself, ‘Who is the one who admits the apparent truth of his own ignorance?’.

Q.: Back to Who-am-I? again, I see!

B.: It is the only useful thing to do.

Q.: What is the purport of this investigation? I mean – what does it aim to reach?

B.: Subjective awareness maintained without volition and without effort is the objective of Atma-vichara.

Q.: If everything is a dream, right now what is the position? I mean: Is Bhagavan appearing in my dream? Or am I appearing in Bhagavan’s dream?

B.: Bhagavan does not dream. He is the Real.

Q.: So it is I who have imagined the great Ramana Maharshi, thus bringing him into existence! How great I must be, to have created not only this whole cosmos, but also Ramana Maharshi himself!

B.: [laughs]

Q.: You see the – pardon me – the absurdity of your thesis that the world is a dream… ?

B.: The world of name and form is the merest of illusions. Only the substratum underlying it is Real and True. Only by right Experience can this be further understood.

Q.: Can you give me ‘the saktipada’? It is said to be transfer of psychic energy from master to pupil.

B.: Who is the master and who is the pupil? In whose point of view?

Q.: I humbly pray that my request be considered favourably.

B.: Catch hold of the “I-Current” and remain still. It will give you all you need.

Q.: How to discover this psychic current?

B.: Once all thoughts have subsided, a steady stream of subjective consciousness remains as the residue. Hold on to it without effort and without volition. It will lead you to the Goal invariably.

Q.: There is said to have lived a saint called ‘Sadasiva Brahmendral’ in South India. He is said to have bodily manifested at the same measured time, at various different locations, perfectly simultaneously! Further, according to the same legend or story, once for some reason the King of the land became furious with him and ordered that his arms be chopped off. This was done.

The saint merely picked up the severed arms with his mouth, and holding them by the skin, betwixt his rows of teeth, demurely walked away from the place, blood trailing along in his wake. Even the slightest twitch of pain could not be observed in him. The king then begged for forgiveness. The saint said nothing; he seemed to be unaware of his environment; he would not even care to look at anyone. Just then, a beetle was about to drown in the pool of blood lying on the ground. Moved by compassion for the hapless creature, the saint dropped his severed arms from his mouth; instead of falling on the ground, the arms magically attached themselves in their original positions, and functioned normally! The saint rescued the beetle, which everyone else noticed only now, and went his way as if nothing at all had happened. What are we to make out of this story? Many otherwise normal people seem to believe in it!

B.: The world is under no obligation to produce forth only those events which lie within the horizon of your ability to comprehend.

Q.: So the supernatural… is real?

B.: Only as real as you are – you as the body or mind.

Q.: If I also try to get occult or thaumaturgic powers such as reading others’ thoughts, moving physical objects using the mind, manifesting objects and making them vanish, predicting the future, spontaneously coming to know of events happening far away, transmutation of base metals into gold, etc., will they carry me towards or away from Realisation of the Brahman?

B.: The latter.

Q.: Why so – may I know?

B.: Because the powers are exercised using the mind. Patanjali himself says, Bahirakalpita vrittir mahavideha tataha prakashavaranakshayaha [Tom: The ‘great bodiless state’ is a state of ‘mind’ that functions outside the body and is unimagined. From this, the covering of the light is destroyed.]. From this it is obvious that the Atman will never reveal itself unless and until one has transcended the mind in its entireity. Whilst I was living in Virupaksha-cave, in 1902 or 1903, a man came who showed me many tricks of the sort you mention. Then he drove Palanisamy out, and showed me his crowing act. Do you know what this crowning act was?

Q.: I am eager to hear it.

B.: [in English] He slanted his body. The lower jaw remained on the neck. The rest of his head rolled off. I picked it up and parted the hair in a neat manner. The half-mouth in my hand, somehow produced the sound ‘Thank you!’ – in English. I smiled at it and fitted it back.

I and another in the Hall who could understand English were horrified; the American coolly said –

Q.: Oh! Really! Bhagavan is sure it was not a mere dream?

B.: [waving at the Hall] As much as all this is.

Q.: Will the omnipotent Bhagavan do the same trick himself now and show me, so that I am convinced?

B.: What you should be convinced about is this – such powers are worthless. They lead you away from peace. The illusionist, once his head was safely back on, wept and wept in front of me. He had learnt these tricks from an occultist by serving him like a dog for three decades; only now did he see the pointlessness, the futility and the evil repercussions of it all. Now he was tempted to perform these everywhere. As a result of the distraction, he was unable to find the time for genuine spiritual pursuits. His peace of mind was now totally extinct. He begged me to take the powers away. To that effect, I gesticulated him to circumambulate the Hill that very night. He replied that it was ammavasai that night, hence he would not be able to see his way. I signalled it was all the better that he be not guided by his perfidious senses, but rather by God’s grace. Thanking me, he went away. I never saw him thereafter. A few days later Palanisamy, it seems, chanced to meet him near the Sona theertham. He had followed my advice, and now was bereft of his psychic abilities. He sent his many thanks to me through Palanisamy. I never heard of him since. So, what is the observation? Even one with such advanced powers finds them a nuisance. Thus you should aim for Realisation and Realisation alone.

Q.: But it is all said to be pre-determined: ‘One shall be able to Realise only if destiny permits it.’ Who knows what she permits? I have heard that Bhagavan himself is not even a determinist, but an absolute fatalist. Am I right?

B.: Destiny cannot so much as cause a ripple upon the introverted mind. Let her do what she will with the body. You merge in the Self.

Q.: ‘Destiny is powerless to disturb the introverted mind.’ Very well. Now – has she the power to thwart a mind that is endeavouring to introvert itself? If yes, what is the use of engaging in spiritual practices?

B.: That power goes on diminishing the more and more the introversion becomes intense.

Q.: I will now frame the question in a slightly different way – If everything is predestined, are my thoughts also predestined?

B.: Do you choose to forsake the Self and think, or do you choose to inhere in the Heart? This is the only choice given to you at any given point in time. The only freedom given to you is to turn inward and drown yourself in the Heart. This is the one and only free-will allowed to man.

Q.: I find nowadays that my faculty of memory often gives me the slip. What is the remedy?

B.: Forgetting [also the fact of] your forgetfulness.

Q.: Is it true that for the south-Indian and Japanese people, Realisation comes easily relative to other cultures on the Earth, on account of conducive psychological constitution caused by appropriate upbringing?

B.: It may or may not be true. But can you help your place of birth? Can it be retroactively changed? Impossible. So, make the best out of the prevailing circumstances and try to direct the mind into the Heart here and now. All other pursuits are ultimately proved futile.

Q.: Am I under any moral obligation to Realise the Self? Is it my rightful duty? Or do I have a choice to remain an ignoramus, should I so please? Is it wrong morally not to Realise?

B.: If and once you practically understand the personal-self to be an illusion [or delusion], the inescapable obligation [to Realise] does devolve on you invariably and automatically.

Q.: The direct means to regain the Absolute – according to Bhagavan, it is the one and only ‘Who-am-I?’ investigation, is that not so?

B.: Yes.

Q.: Why so?

At this point, Bhagavan said something to an attendant, whereupon the latter extracted a heavy-looking volume from the book-case in the Hall. The book was handed to Bhagawan. He opened it once and it had opened onto the very page he had been aiming for; this curious knack I have already noticed many times in the master. He handed the open book to the interpreter, and gave him some instructions. Presently the interpreter read as follows –

The following are the words of the Tibetian Yogi Milarepa:

‘Oh! Ignorant mortal! When you run after your thoughts, you are verily a dog chasing a stick. Everytime a stick is thrown, you run after it. Instead be like a lion. The lion, rather than chasing the stick, turns to face the thrower. One only throws a stick at a lion once.

‘Oh! Ignorant mortal! Know this for certain – all worldly pursuits have but one unavoidable and inevitable end, and that is sorrow. Accquisition ends in dispersion, building in destruction, meetings in seperation, births in death, and so on. Knowing this, one should, from the very beginning, renounce accquisition, accumulation, and the like.

‘Oh! Ignorant mortal! How long will you go on dreaming, rotting in this odious marsh of births and deaths? Do you not want to taste the sweet, intoxicating nectar of immortality? For this, investigate your “I”. Do not entertain hopes or ambition for Realisation, but sincerely practise all your life.’

Q.: Are there pre-requisites or qualifications needed for one who wishes to follow this path of inquiry?

B.: Only one – complete absence of belief in the world as an objectively real, self-supporting, or continuous entity.

Sri Ramana Maharshi on the heavenly realm of Shambala and the secret of Mount Kailash | Aham Sphurana

The following is taken from Aham Sphurana 19th July 1936:

Sri Bhagavan [Ramana Maharshi] was given a sheet of paper filled with questions. He asked the interpreter to read them out:

1. The heavenly realm of Shambala is said to be located somewhere in Tibet. One who merely visits it once is said to be absorbed in Bliss forever. Is it so? Is it acceptable for ordinary mortals to aspire to locate and enter the place? Does the place actually exist, or is it a mere mythical construct? If it is there, how to find it, since the mountainous region is largely unchartered?

2. What is the secret of Mount Kailash? Does Lord Shiva really reside at the top of the peak?

3. It is said that if a sinner touches the mountain, he suddenly ages 2 decades in a span of 2 minutes. Is this true?

4. Is Mt. Kailash the axis mundi of the earth? Does it give access to the hidden realms of heaven that are frequently mentioned in the Hindu scriptures?

At this point, Bhagavan asked the interpreter to stop reading, and said to the young man who had presented the questions:

Bhagavan Sri Ramana Maharshi: Look here, I don’t know anything about such things.

Questioner: But B. is widely regarded as a Sarvagnar [Tom: ‘all knowing’ or omniscient].

B.: People foist on me whatever they like. What am I to do? The kingdom of Heaven you seek is within. It is to be found by turning the mind inward, not by journeying to all sorts of impossible places.

Q.: If all places are the same, why did Bhagavan leave Madurai and come to Tiruvannamalai?

B.: Always the same question! You want to go to all sorts of exotic locations. I did not [personally] desire to go anywhere; rather, I was pulled here.

Q.: The same fascination you have for Mount Arunachala, I have for Mount Kailash. What is wrong in it? Both are dwelling places of Shiva.

B.: Right. You may do as fancy pleases you. Why solicit my opinion?

Q.: It is difficult to reach the mountain. Not many have succeeded. I want Bhagavan’s blessings so that I may succeed in safely reaching there. If I once have darshan of the mountain, it will do. Even if I drop dead the next moment, it
matters nothing. Will Bhagavan please Bless my endeavour? I plan to start 2 weeks hence.

B.: [smiles]

Q.: Can I take it that Bhagavan’s blessings for my journey are descended upon me?

B.: Yes.

[Tom’s comments: what is it that we really need to know for liberation?]

Ramana Maharshi: If I am not the body, why do I feel physical pain? Aham Sphurana

The following is taken from Aham Sphurana 17th July 1936:

Questioner: Is it really true that I am not this body?

Bhagavan Sri Ramana Maharshi: Yes.

Q.: If so, when some damage is suffered by the body, why do I feel pain? If, say, a piece of burning coal falls on somebody near me, I do not feel anything, but that person alone feels the pain. Likewise if a thorn pricks my foot I alone feel the pain, but not the one walking by my side.

B.: Does the body cry out, saying, ‘I am feeling pain!’? You associate yourself with your body and speak of it as your “I”. The body is only in the mind. All pain apparently suffered by the body is as imaginary as the body itself. The body cannot know anything. It is insentient flesh and bone. Notions of pain spring from our own imagination only. Thus, in deep slumber, the mind being inactive, there is no pain.

Q.: Suppose I have a piece of metal wire in my hand. If I cut it into pieces, the metal cannot be aware that it is being cut, because it is insentient. Whereas, if a living body were to so much as be scratched, it explodes with agony. In what sense, therefore, does Bhagavan mean that the body is insentient?

B.: True the body experiences the physical stimulus of pain if it is injured, but why should that fact create a thought in the mind, “I am feeling pain”? Physical pain creates mental agony because of the following reason – the mind assumes itself to be the body and appropriates to itself the bodily identity, because in the absence of such false self-objectification it cannot survive or thrive. If the idea “I am the body” is abandoned, everything, including pain suffered by the body, is only Bliss.

Q.: But I am aware of the pain if the body is injured!

B.: When the body is injured, in the case of the unenlightened one, the following happens – his body feels the physical stimulus of pain, and his mind spontaneously manifests the thought, “I am injured”, causing him to become mentally agitated; the reason for the manifestation of such thought is the underlying erroneous idea “I am the body”. In one who is free from the mistaken idea of accepting the body for the Self, injury of the body causes no disturbance to his peace. Each one is indeed the Self, but absurdly confounds himself with the not-Self and so needlessly suffers on account of such dehatma-buddhi [Tom: the idea ‘I am the body’; deha = body; atma = self; buddhi = intellect or understanding or knowledge].

Q.: The question still remains – if, as postulated by Sri Bhagavan, the body is insentient, how can it and why does it feel pain at all?

B.: The word “pain” is employed because there is a prejudice in the mind against such stimuli. When the mind is dissolved in Pure Consciousness [Tom: ‘Pure Consciousness’ means consciousness devoid of arising phoenomena/objects], its prejudices also disappear. For the enlightened one, therefore, pain and pleasure are physical stimuli that stand on an equal footing. He does not covet the one and abhor the other; nor does he abhor the one and covet the other. Mind gone, there remains no yardstick by means of which one sensation is to be regarded as pain and another as pleasure.

Q.: Sri Bhagavan seriously means to say he is unable to tell the difference between the sensation that ensues when an insect bites his leg and the one that ensues when someone is massaging it?

B.: That they are different sensations is self-evident; that the one is abhorrent and the other agreeable is mere mental judgement from which the Jnani is quite free. He himself seeks out neither pain nor pleasure, but accepts what comes his way without resisting; in Jnana only automatic acceptance remains.

[Tom’s comments: we can see here that Bhagavan is answering on the level of dristi-sristi vada]

Q.: For Jnanis it is different; what of the common man?

B.: You also are a Jnani; only, you think otherwise!

Q.: How could that be?

B.: The option of turning inwards and quietly allowing the mind to plunge and dissolve in the Self is equally available for all. It is not the fiefdom of a select few. All are verily only the Self.

Q.: That does not satisfy me. I am unable to Realise it for myself.

B.: So long as worldly attachments are present the mind cannot be succesfully turned inwards.

Q.: How to eliminate worldly attchment?

B.: By turning the mind inwards.

Q.: Really!

B.: The more you hold on to the Self or retain the mind in its native state of subjective-awareness-sustained-effortlessly-and-volitionlessly, the more the mental tendancies and worldly attachments wither off; the lesser the mental tendancies and worldly attachments, the easier does become retention of the mind in its native state of subjective-awareness-sustained-effortlessly-and-volitionlessly. [Tom: like the phrase ‘Pure Consciousness’ used above, this ‘native state’, native referring to the birth-place or source, means consciousness of Pure Subjectivity only, devoid of any airisng phenomena/ appearances/ objects]

Q.: Which comes first?

B.: The sadhaka recognises and reflects upon the ephemeral nature of the objective world and the transient nature of his own body. He gets fed up with material pleasures, because they eventually lead only to sorrow, when their enjoyment becomes, for any reason, impossible. He asks himself if a more permanent experience of life might not be possible. Then he discovers the Ajata-advaita doctrine. Initially he is not convinced, and argues that if it were a dream there would be no possibility of corroboration, but that here his relatives and friends are able to confirm the evidence provided by his senses; he also asks why the same dream should be repeated everyday, were it all only a dream – according to him, here he sees the same sun, moon and earth everyday, whereas in his dreams he finds himself in new worlds moment to moment. Eventually it dawns upon him that everything he thinks he knows, including an understanding of the apparent permanency of the world he believes himself to live in, is only thought or imagination.

Then at the intellectual level he understands the truth – that the names and forms constituting the world are fictitious. This sparks a search for the substratum said to be underlying them, which alone is said to be Real by the wise. He hears the teaching that the source of the mind, Beingness, is the gateway to the Real Self. Then he begins the practice of quietening the mind by vichara or any other method, tackling various distractions as and when they arise, by withdrawing attention from them and fixing it on Beingness or the Self. The beginning is only becoming fed-up with the evanescent nature of the world and the fugacious attractions it has to offer.

Q.: The boubts Bhagavan mentioned – they are my doubts also. Why is everyone witnessing the same dream? The sun moon etc. are seen by all.

B.: In turn those ‘all’ are seen by you only. In deep slumber when there is no mind, nothing is available to be seen, but your existence is a constant.

Q.: Why do I dream the same dream everyday? For instance yesterday I came to the ashram and had darshan of Bhagawan; he was sitting on the same sofa in exactly the same manner. Today I am seeing Bhagawan and tomorrow also it is going to be the same Bhagawan.

B.: The future is a mere mental projection. The past is a mere memory. Have you not had dreams where the places you visit look extremely familiar?

Q.: At least is the present real?

B.: Anything seen cannot be Real. What is seen is not Pratyaksha [Tom: directly known]. It is not self-evident, because there is a subject-object relationship involved. It is merely sensory information that is fed into the mind by the strength of its own evil faculty of avidya-maya. That alone is Real which shines by its own light.

You are asking about the objects of the world. Can such objects exist without a YOU, a perceiver? When there is no perceiver, as in swoon or deep slumber, is there anything to be perceived? No. What is the inference? The objects owe the appearance of their apparent existence to you only. They are merely mental creations. The appearance of this enormous cosmos around you is merely… a mental information. The mind is fiction. Therefore the ‘objects’ manufactured by it are also fictitious. Have not the least doubt about it.

Q.: If everything is unreal, can we conclude that bondage and liberation are also unreal?

B.: Yes.

Q.: Then why should I try to obtain Liberation? Let me remain as I am.

B.: Exactly!

Q.: I do not understand.

B.: Remaining as you are is the loftiest Sadhana.

Q.: How can remaining in ignorance be sadhana?

B.: You think that you are in ignorance. When you do not think at all, what remains is only wisdom. Removal of the screen of thought is all that is required for Reality to be revealed. Since you want a sadhana by means of which you may reach this thought-free state, vichara is suggested. Actually there is no need for any sadhana for one who has mastered the art of remaining as he is – the art of Being. That is the import of the advice Summa Iru [Tom: ‘be still’ or ‘just be’]. People generally misunderstand it. It does not mean keeping the body idle. It means keeping the mind still or free from thought. Remain perpetually absorbed in the thought-free I-Current. This will automatically lead you to the Sahaja-stithi [Tom: Natural state] without requirement for further effort.

Q.: Is even desire for Liberation an obstacle to Liberation?

B.: Yes.

S>M>

Q.: Why has God created the world? I want to know why.

B.: Did God come and tell you that He has created the world?

Q.: I see creation around me. There must be some reason for creation.

B.: You say “I see.”; if you see that seer, all your doubts will be resolved.

Q.: I do not understand.

B.: Is there anything to be seen in sleep?

Q.: No.

B.: Continue to remain in the state where there is nothing to be seen.

Q.: Should I always be sleeping?

B.: Not seeing anything while remaining AWARE is Realisation. That is God and that is everything.

Q.: Awareness of what?

B.: Being.

O Bhagwan, Amidst your Eyes lie the Immortal Ocean – a Poem by Aman

The following is a poem written by Aman, an attendee at Satsang, and this is shared with their permission:

O Bhagwan,
Amidst your Eyes lie the Immortal Ocean,
The Self that I am,
Which revealed itself in the Luminous rays of Your eyes,
May the waves of Love drown me deeper,
May all objects dissolve,
Revealing You alone that is Real.

O Bhagwan,
Gently lying covered in loin cloth,
Which is like a single look from the Sun,
Revealing the Light of my Being;
All multiplicity begins to vanish,
And that Love alone remains.

The mind seeks constant experience,
Arrive and dwell in the Ocean that needs absolutely nothing.
Reveal me as The Absolute,
The pure existence that alone is Truth,
The pure consciousness that is the substratum,
Which reveals no objects existed,
The pure limitless fullness,
The nectar of infinite light.

O it is the splendour of Your sun
Which fills my being with its vastness,
Dissolving all trace of myself
Lost within this illumination,
The splendour of Bliss,
Revealing It alone exists

The cave of the Heart,
Dissolution of the I-thought,
Absolute Consciousness
All things become inert;
What seemed like a mirage,
Merely droplet of sweetness upon the tongue of limitless Nectar,
Nothing compares to Thee;
What appears other,
Merely the fancy of the mind,
The imagination’s finite copies dreaming

But who dreams?
Who sees objects?
And all at once
It starts to be only Bhagwan

Take me where
Nothing was created,
Nothing existed,
Nothing needed to happen,
Beyond time,
Beyond conception,
Do you feel this Serenity?

Infinite Love so fulfilled
And in Bliss;
Why would stirring, movement, or creation have to occur?
The Nectar of Peace,
The ocean that rests in tranquility,
The hum amidst the Silence.

Om Shanti Shanti Shanti Om

Om Namo Bhagavate Sri Arunuchala Ramanaya Om

Ramana Maharshi: How to rid oneself of the ‘I am the body’ idea? | Manonasa | Aham Sphurana

The following is taken from the text Aham Sphurana, 19th September 1936:

Questioner: In ‘Ulysses’ we find Mr. Joyce to have deployed the words, “And we stuffing food in one hole and out behind: food, chyle, blood, dung, earth, food: have to feed it like stoking an engine.” I am frequently beginning to think on such lines now-a-days. We feed and clothe the body; we find for it a warm shelter to live under. In return, what is our gain? The body keeps getting new diseases and fills us with agony and misery by putting us in pain. This is a traitorous body which returns evil for good. I don’t want it anymore. Is the body a gift from God? Is it a sin to refuse to remain in acceptance of it anymore?

Bhagavan Sri Ramana Maharshi: It is not so easy to get rid of the body. Physical annihilation of the body might remove it from this earthly realm, but again your mind will find another body for you. The body was manufactured only by the mind. There is only one way to kill the body: that is to kill the mind. Mind dead, not only does the body die, but also the whole of the cosmos. Our effort must therefore be directed toward killing the mind, not the body.

[Tom: Bhagavan is stating that it is the mind, also known as ego or ignorance, that ‘manufactures’ or creates/projects the body as well as the world and entire cosmos. If we merely kill the body, the mind will project a new body to inhabit, so samsara does not end. However, if we kill the mind, that is realise the self and thereby destroy ego/ignorance, then all that will remain is the worldless formless Self]

The body is not a gift from God inasmuch as God never asked you to take the form of the body – i.e., to imagine that you are one and identical with the body. You ask what is gained by holding on to the body. Who is it who says he is holding on to what he refers to as being his body? Discover the identity of that villain. Then you Realise that you never did have any body. The body has nothing to do with you.

You are bodiless always. Realise It. How? The same Mr. Joyce mentioned by you also writes, “…remember, my dear boys, that we have been sent into this world for one thing and for one thing alone: to do God’s holy will and to save our immortal souls. All else is worthless. One thing alone is needful, the salvation of one’s soul. What doth it profit a man to gain the whole world if he suffer the loss of his immortal soul? Ah, my dear boys, believe me there is nothing in this wretched world that can make up for such a loss.” If the soul is immortal how can it be lost? So, what is attempted to be communicated? The Immortal and Imperishable Soul is seemingly lost because of avarana [Tom: the veiling power of tamas]. That is the meaning. To tear asunder this veil of iniquity is the one and only relevant goal of one’s life.

Q.: And it can be accomplished by asking oneself, ‘Who am I?’?

B.: People who come here say, I practise the investigation ‘Who am I?’ for an hour each day, or for a few hours each day. What can we say to them? It is not a practice that is to be pursued a few hours each day. It is a fundamental change or shift in the direction in which one’s extroverted mind happens to incumbently be oriented. Relentlessly pursue the investigation day-in and dayout till the Self is Realised.

Q.: How can the investigation, which seeks to curb thought, be at all combined with activities that necessarily entail thinking?

B.: With persistent practise of the practice, activities – that you now think are being done by you – will automatically go on effortlessly. Your intervention will then be unnecessary – in fact, impedimentous. We are under the impression that we do things. What is the fact? It is the Higher Power that does everything. Is it the chiselled figures found at and forming part of the base of the Rajagopuram that bear the weight of the same? Is it not the earth that bears the entire load? Yet those sculpted figures have facial features that are wildly contorted with the evident strain of carrying the huge structure. It is a clever, artistic sham. Likewise here. The ego never does anything, but simply appropriates to itself credit for the body’s actions, which happen exclusively and spontaneously in accordance with Ishwara’s pre-destined script for it.

In other words, thoughts do not cause action to take place. Actions always go on only of their own accord: only we assign to them a spurious sense of personal doership or individual agency, and suffer thinking that free-will is real.

Q.: But actions follow thoughts. First I think and decide; then I act accordingly.

B.: That is just what is NOT true.

Q.: How so?

B.: The apparent causal-synchronicity between thought and action is a sham. That alone transpires which is destined to transpire. The preceding thought motivating the [body’s] action is not the result of free-will. Why? Because there is no such thing as free-will. How then is there cohesion between thought, which occurs first, and action, which occurs in subsequent concatenation? It is because the extroverted mind is also subject to destiny, just as the body’s actions are subject to destiny.

Q.: How cheerless to think that free-will is a myth…

B.: It cannot be denied that from the standpoint of the individual person free-will is indispensable. But where is the need to be an individual person when you can BE THAT?

Ramana Maharshi: Jnanis and Avatars – Aurobindo, Meher Baba, Krishna, Jesus, Buddha | Ask and ye shall receive Aham Sphurana

The following is taken from the text Aham Sphurana, 7th July 1936. Please see here to find out more about this text:

Questioner: Yes, some say Aurobindo is the Avatar of the age, while others say it is Meher Baba; still others say it was the late Sai Baba. Yet others maintain that Sri Krishna was the last Avatar in the Anthropomorphic form, before Kalki Avatar arrives at the time of Cosmic Dissolution. For others it is Buddha, Ramakrishna or Confucius. Will Bhagavan tell us in what way His experience of consciousness is superior to that of these, since, allegedly, they seem to be mere Avatars, and not Jnanis? And really who is the Avatar corresponding to this Era in Mankind’s history, a particularly tumultous one – Germany has announced her intention to rearm herself, an indication of the belligerent attitude of the National Socialist Government? Surely an Avatar is necessary from age to age to look after the world to ensure that mankind’s evil-doing collectively remains lesser than his acts of benignness? Jnanis do not act in the world, except to ensure the merest existence of the physical body, is that not so? So, where is the Avatar who is going to look after our poor mortal selves- and also the world?

Bhagavan Sri Ramana Maharshi: Experience of Consciousness, if genuine, naturally precludes ‘others’; thus there is nothing superior or inferior, because there is no second, no other, nothing foreign or alien to or apart from the One Immutable Absolute Self – so the question of comparison is, simply, nullity.

All True Masters are ONE, not because they identify themselves with something in common, but because commonly the faculty of identification [of one thing with another] does not exist in any of them. As for Avatars, each one sees an Avatarapurusha [Tom: purusha means person] according to his own mental convictions and predispositions – to establish the finality of one’s own viewpoint admist others will result only in fruitless skirmishes. You may continue to believe in whatever pleases your own fancy, but expecting corroboration from others for your weltanschauung [Tom: world view] of the universe will serve only to increase your sense of mental unrest and agitate the mind further.

Q.: So the idea of the Avatarapurusha, God-manifest/God-incarnate, who comes down from age to age, is just… a fallacy, only as good as a fairy-tale? Do not the Holy books of the various faiths speak of these blessed beings, whom we might worship – since manifestation makes available a form to worship – so that we might elevate ourselves to the zenith of spiritual perfection and purity, puissance and divinity? Jesus, Mahomet, Zoraster, Buddha – what about them? Specifically does not Krishna say, parithranaya sadhunam… etc.? How can these considerations be ignored?

B.: Your mental predilections and proclivities foist upon you the erronous idea that there is a God outside your Self, and that He sends down messengers to guide you and show you the way to reach Him. If you keep on journeying, you will never reach. Therefore, I say, enough searching – call off the search and be yourself, nothing more. The great masters – each in his own tongue, but each from the same Heart – yearned to give you this message only – BE YOUR SELF.

The Masters you mentioned, and others, each doubtless had – and has and continues to have always – his specific, special or unique role in man’s spiritual evolution, but the zenith spoken of by you will certainly not be reached by discussing the question, ‘How can all of these Mahanubhavars be right? On what points do they contradict themselves? Is it not our imminent task-on-hand to clear up these apparent contradictions and seeming mutual inconsistencies? Will that not endow us with special spiritual merit?’ Men waste entire lifetimes – fruitlessly – like this. This effort, if harnessed fully to keeping one’s Latchiyam [Tom: aim or target or goal] fixed entirely on Self or Reality, would have resulted in Mukthi long ago. Instead, countless lives have been frittered away on account of these wrong and foolish ideas about reaching Truth by using the Buddhi or the resoning faculty, when, in fact, precisely subsidence of that faculty results in revelation of Self or Reality. What a pity.

Q.: It is still not clear. The Avatara Purusha – is he just a mental concept like the gandharvas, rakshasas, bhutas, etc.? Has not this tangible world witnessed the advent of many such great men, Bhagavan himself not excluded?

B.: The trouble arises when we use their teachings to satisfy our intellectual palate and appetite. To the unwise, it does not occur to try and practise, instead of using it as a subject of discussion at gatherings of philosophers and metaphycists.

Therefore I say – Do not try to write essays on it. Do not try to present articles of great erudition on it. Do not try to gain followers for your newly discovered maxim or device-of-apotheosis or precept-of-ancient wisdom. Do not conceptualise it mentally and then, getting trapped in those very concepts, moan and complain that you ‘see no progress’. Do not go on discussing or talking about it. Do not tell yourself, ‘First I shall obtain intellectual mastery over the technique and subsequently shall begin the application thereof.’

Instead – plunge into the practice HERE and NOW; stick to the teachings of any one Mahanubhavar, and all will come right in the end.

Masters are there only to show you the way – man fogs the fulfilment of their purpose by merely theorising or intellectualising about their respective lives, advents and teachings, such as asking – Is this one or that one a Siddhapurusha, Muktha-purusha or an Avatara-purusha? Of course these are your mental concepts only. In fact, the Master, being not at all different from the formless Absolute seated in the tabernacle of the Sacred Heart of Man, is really synonymous with your own True Self – why seek him anywhere else?

Q.: For myself I am now convinced, but I am worried about the hopeless spiritual condition of the world, which seems to be enveloped in profuse darkness. When will all the people of the world wake up to the fact that they are living in the ghastly darkness of ignorance, and understand that the world around them is a dream, so that they can obtain genuine illumination? What about those unfortunate ignorant millions of the world, who have never met a genuine Sadhguru in their life? Supposing their prarabdha-karma dictates that they spend the entireity of their lives being relentlessly tossed around in the evil sea of avidya maya, as a result of the Guru’s accquaintance never coming to transpire- what then? For how many lifetimes more will their ordeal of ignorance have to last, and when at last would such unfortunate ones meet their Guru- so that through Him their redemption could be vouchsafed for certain? Such unfortunate persons, never having had the extreme good fortune of meeting B. during his blessed sojourn on this Earth, which, owing to his stay here has become itself a sanctified land, must needs count themselves exceedingly unlucky- what, therefore, would Bhagavan have them do? What can they do? What will be their fate?

B.: The fate of each one depends upon his merit. Take care of yourself and others can take care of themselves.

This answer was evidently not to the questioner’s liking. He seemed to toy with the idea of placing forth additional arguments before Bhagavan as to why mercy ought not to be showered in profusion upon the ‘ignorant’ masses of the world, until Chadwick pacified him with the following words:-

“Bhagawan has said that when longing for God or intensity of meditation has reached a feverish intensity/pitch, the Guru automatically manifests before the devotee.”

Even then, the man seemed about to say something, when the Hall’s attention was riveted by Bhagavan’s voice suddenly reading from Scripture the words of a Jewish Carpenter no less a genius in the realm of Spirit, the heartthrob of many a lonley, man-forsaken soul yearning for Divine acceptance –

“Ask, ye shall receive; Seek, ye shall find; Knock, it shall be opened unto thee.”

Ramana Maharshi on Aurobindo’s Intergral Yoga – bringing Divinity back down into the world after Self-Realisation | Aham Sphurana

The following is taken from the text Aham Sphurana, 7th July 1936. Please see here to find out more about this text:

Questioner: I am aware that Bhagavan is a solipsist. However, to dismiss all human problems as being imaginary requires a giant leap of faith towards the Idealism end of the spectrum.

Bhagavan Sri Ramana Maharshi: It merely needs disillusionment with materialism.

Q.: According to Sri Aurobindo’s claims, he has probed beyond the experience of the Vedic Rishis. What is Sri Bhagavan’s opinion? Is it authentic or not?

B.: Aurobindo’s talk of bringing down divine consciousness from above overlooks the same being already Self-effulgent in the Heart. Reality simply IS. Where arises the question of moving it from place to place, etc.? People keep asking me about Sri Aurobindo’s yoga system; and if I give my reply according to my capacity, they go away disgruntled saying, “These Jnanis are always contradicting each other.” What can I do?

Q.: What about Sri Aurobindo’s claim that one must commence from Self-Realisation and then proceed to bring down the Divine to the Earth?

B.: Let us first Realize and then discuss, if need be; not now.

[Tom’s comments: Sri Aurobindo’s view was that once the truth was realised, it should be ‘brought back down’ into the level of the world, in what he called Purna Yoga or Intergral Yoga. Sri Aurobindo rejected the notion of Shankara or Vedanta that the world was unreal or ‘maya’, stating that the world is a real expression of the divine, and that the purpose of spiritual teachings is not nirvana or escape from samsara, but instead to enrich and enliven the lives of people here in this world and help people live divine lives here on Earth. Sri Aurobindo felt that the Vedic rishi’s had discovered the Truth, but had not learnt to or were not able to or even inclined to bring it back down to Earth, and that the notion of the world being an illusion was a result of the failure to bring the Divine back down to the Earth.

Here is a link to a chapter on Integral Yoga by Sri Aurobindo for those interested on these points, where he defines Purna Yoga and explains his view on the above points I have made: https://sri-aurobindo.co.in/workings/sa/37_28/02_004_e.htm

Sri Ramana in response to the questioner is saying how can Truth be ‘moved’ anywhere, let alone ‘back down’ into the world? ‘Reality simply IS’. The implication is that the very notion of bringing truth back into the world is based on ignorance or non-realisation of the actual truth]

Q.: What is the ultimate purpose of a man’s life?

B.: To find an answer to the question of “Why am I, apparently, limited to, and therefore by, a body? Am I nothing more?”. This question finally resolves itself into the question of “Who am I, who am apparently bound by this limitation of being or carrying a body?”. This much is certain: one who foolishly takes his bodily existence for granted, who thinks that it is an inevitable finality that he is, in fact, born, will never succeed in the Quest no matter what austerities or penance he might perform.

Only the Unborn can know the Unborn. The Unborn knows itself only – that is, it knows no birth or death. The intellectual understanding that the bodily existence is futile, undesirable, useless and delusory is the very first step towards Realisation. If you accept the existence of limitations [Tom: eg. if you accept or start with the premise that you are a body-mind entity, or that the world is real], any Sadhana performed will have precisely only one result – it will make the Ego grow stronger and stronger and stronger. One who wants to transcend limitation should cease to imagine himself to be limited – that will do; yes, it indeed is as simple as that. Instead of simply giving up the unreal, people want to do Sadhana to eradicate it! Is it not funny?!

Q.: Is Sadhana not useful?

B.: Only if it is done without assuming the existence of limitations. The only useful Sadhana is the investigation “Who am I?”. Everything else is just “release-of-concept-gas” [movement of mental ideas or churning of vrittis within the mind], because existence of limitations is implicitly assumed and accepted. If non-existent limitations are accepted to exist, how can any Sadhana performed on the basis of that wrong acceptence have any use, and how can such spurious Sadhana help you transcend those very limitations?

Q.: The logic seems to suggest that the Self can be discovered by the mind.

B.: The dead mind becomes the Self or discovers itself to be the Self.

Q.: I understand Nietzsche talks about the concept of Eternal Reccurrance of the same in Also sprach Zarathustra. Does B. agree with it? Each time the universe is recreated after the cosmic dissolution, does it exactly repeat itself? If that were to be true, both free-will and Self-Realisation would be impossible. If everything is going to unfold now exactly as it did previously, my incumbent free will is obviously just a myth. If everything is going to unfold in exactly the same manner in the future as now, I am never going to escape from the cycle of births and deaths!

B.: All these are only mental concepts. Even now you are not born. Realize it.

Q.: The body was born.

B.: Are you it?

Q.: It is part of me – Bhagavan’s teachings tell me that I am Brahman and therefore immanent everywhere.

B.: Leave Brahman alone. Talk about yourself first. Who are you?

Q.: I really don’t know… I am Pure Consciousness, is it not?

B.: Is Pure Consciousness now conversing with me? Is it is saying, “I am Brahman.”, etc.?

Q.: Then what is the answer?

B.: The effortless thought-free state is the answer.

Q.: How to attain it?

B.: There is no question of attaining anything. BE – don’t ask how to be. It is your very nature.

Q.: I am unable to realize it.

B.: This is also only a thought. Get rid of it and all will be well.

Q. I have heard of the Jnana-vichara technique expounded by Sri Bhagavan. How could asking oneself the question ‘Who am I?’ lead to transcendence of mind, when asking the question itself is only an activity initiated and sustained on the level of the mind?

B.: The vichara begins with the mind and ends in the Self. Mind turned fully inward discovers itself to be the Self.

Chadwick was asked by Bhagavan to give the man Bhagavan’s ‘Who am I?’ to read. He read it and then asked –

Q.: I find it shocking to consider seriously Advaita’s proclamation that the Jagrat state [Tom: waking state] is nothing better than a dream. It amounts to saying that I am now dreaming whereas I believe to the contrary, that whatever I am experiencing through the senses exist independantly of my perception thereof… How is it that the numerous disciples of yours – or followers or devotees or worshippers or afficionados or whatever it is that one would be justified in calling them take gladly to the idea that the world – the same world they experience everyday – is a dream?

B.: You say it is the same world you saw yesterday that you are seeing today. How do you know that? Through memory. Memories are also illusory. They create a deceptive fabric of intellectual continuity where in fact none exists.

What actually exists is only Beingness or Self. Even in dreams you have memories, go to familiar places, etc. How is it? Jagrat or Swapna, the same mind draws the poisonous veil of objectification or differentiation over the pure Self, hiding it. This veil is called the screen of avidya maya. Don’t ask, who cast this veil? Instead, ask, who sees the veil? Then you will see there was never any veil. This is called Self-Realisation. The desire to do sadhana to attain it is itself meaningless because it presupposes the existence of someone apart from the Self who is doing Sadhana to reach the Self.

Q.: Is it the realisation you speak of as Sahaja Nirvikalpa Samadhi? Should I not do any Sadhana? Is Sadhana useless then?

B.: Yes, it is the same realisation. Sadhana is the means to gain the Self. Only the idea “I am doing Sadhana” renders the Sadhana totally pointless and useless. Sadhana becomes natural if attraction to worldly pleasures stands removed. Desire for worldly pleasures take to their heels when you realise the world is only a dream.

Q.: I still find it impossible to believe this solid world could only be a mere dream.

B.: [smiling] Two different categories of spiritual aspirants or sadhakas exist. One is the Spülauftrag [Kritopasaka] and the other is the Wischauftrag [Akritopasaka]. [Bhagavan sometimes used words in the questioner’s native tongue to drive the impact home, or where technical terms were involved.]

[Tom: Kritopasaka refers to those who have done sadhana previously, eg. in a previous life, and so who are mature seekers, akriopasaka is the opposite; Spulauftrag (‘rinsing task’) means that task which only needs to be washed or rinsed, whereas Wischauftrag (‘wiping task’) refers to a task in which some wiping or scrubbing is first required before rinsing/washing can take place]

The former is born with the intellectual conviction, born of aeons of serious and steadfast spiritual practice directed along the correct channel [that of making the mind turn Selfwards or Sourcewards], that the cosmos he sees around him is the merest of illusions, and that expending one’s mental faculties upon it would be the ruin of one’s inherent nature of abiding peace and unshakeable happiness; whereas the latter is shocked and unsettled when informed that there is no difference – for all practical purposes – between the Jagrat [Tom: waking] and swapna [Tom: dream] states.

The firm intellectual conviction that the perceived cosmos is seen, owing to delusion, as being constituted by multiple disparate entities while the truth is that it is vested in the same Substratum, Adhishtanum [Tom: substratum], or Sadhvasthu [Tom: Sad = true or real; vastu = thing or substance or reality] as the Seer, is born only as a result of arduous spiritual practice which is possible only if the Sadhguru’s abundant Grace is available as a catalyst, which Grace descends unto him alone who perpetually bathes his heart in the effulgent glow of unselfish and non-reciprocation-expecting love of God, Humanity or any other single-minded ideal of pure, ecstatic devotion or parabhakti, and this intellectual conviction [as to the world’s objective unreality] is the seed of Jnana that grows into the tree that chokes the poisonous weed of Egotism or Ahankara at its root, destroying it once and for all, such seed having been planted long ago in the fathomless, dark misty depths of the mind by way of the Supremely merciful glance of Grace of the infinitely compassionate Sadhguru.

Q.: So, the widely held perception that without a Guru, even Atmajigyasa [Tom: the desire for self-knowledge], leave alone Atmasakshatkara [Tom: Self-realisation], is totally impossible, is…?

[he left his words trailing in the air, for the Sage to rythimically conclude,]

B.: Unequivocally and absolutely correct.

Ramana, Birthdays & The Deathless | Sri Ramana Teachings

In this Satsang moment with Tom Das, we explore death, non‑duality and the deathless truth that is never born and never dies. In this short clip that follows a longer talk on death, recorded in the video “Facing Death, Finding The Eternal”, Tom shares why Ramana Maharshi felt it made no sense to celebrate his birthday, and points us back to the timeless Self beyond birth and death. Tom also speaks about the dangers of organized religion when it loses its living spirit, the importance of not throwing out the “baby with the bath water,” and the risks of so‑called new religions that claim to offer a brand‑new way to the same eternal truth. With a gentle tone and the occasional hard‑hitting insight, this satsang invites you to question second‑hand beliefs and look directly at the unchanging awareness that you are.

This video was recorded live during a Satsang meeting with Tom Das on January 22nd, 2026 and put together by volunteers.

To download full unedited satsang recordings see here: https://payhip.com/tomdas

To attend satsang, see here: https://tomdas.com/events

For guided meditations see the ‘guided meditation’ playlist here:     / tomdasnonduality  

For recommended reading for liberation see here: Recommended Reading: Books for Enlightenment, Liberation and Self-Realisation

Q. Why are some of our prayers not answered? How to know if a Jnani is genuine? | Sri Ramana Maharshi | Aham Sphurana

The excerpt below is taken from the text Aham Sphurana (see here to find out more about this text and download a copy for free), 20th July 1936:

Questioner: It happens to some that they pray – in all good faith – to God, yet their prayers are unequivocally repudiated. What is the reason?

Bhagavan Sri Ramana Maharshi: Can you be trusted to know what is best for you?

Q.: I should hope so.

B.: That is your opinion.

Q.: What then is Sri Bhagawan’s opinion?

B.: ‘O Lord, thou hast searched me, and known me. Thou knowest my downsitting and mine uprising, thou understandest my thought afar off. Thou compassest my path and my lying down, and art acquainted with all my ways.’

Q.: The implication being?

B.: He knows what is best for you; you do not. Therefore unconditionally surrender yourself to him and leave your fate in his hands. That is the only thing to be done. Prayer is merely a lower form of surrender. It is highly prone to failure, because if what is asked does not aid Realisation, it may not be granted, even though you may be thinking that what you are asking is going to [serve as an] aid in Realisation. Or, your karma may not permit the request to be granted.

Q.: Spiritually-inclined people pray for strength to inrovert the mind. Or, they pray for Self-Realisation. How can that be not an aid in Realisation?

B.: Because it posits the dangerous notion that there exists an [individual] “I” who craves for himself the state called Realisation. Such prayers are unnecessary. Maam Aekam Sharanam Vraja. ‘Only surrender to Me.’

Q.: Why does God allow karma to meddle with even the efforts of sincere aspirants who are trying to Realise?

B.: The arrangement of karma – [for karma itself is] unavoidable – is actually adroitly done in such a way as to give the sadhaka the maximum possible chance of completely cleansing the mind of all vritts. So, if you are destined to Realise in this lifetime, rest assured that your karma has been ingeniously arranged in such a manner as to inevitably take you to the Goal.

Q.: And if I am destined otherwise?

B.: Perhaps you would not be here today.

Q.: The same astute God who manipulates karma so carefully – why was he not careful enough to safeguard the Self from slipping into the bondage of ignorance?

B.: Does the Self complain of having thus fallen?

Q.: No. But I do.

B.: Are you apart from the Self?

Q.: The mahavakyas state that I am supposed to be one with Brahman.

B.: And your Experience is in Corroboration?

Q.: Alas! No. All I feel is the miserable ego.

B.: Yes. Misery is one with the ego. Kill the ego.

Q.: It seems to be an impossible accomplishment even for those with decades of systematic training in the spiritual field.

B.: There is no accomplishment possible. What is intimate and inherent cannot be accquired. The only thing to do is destroy the useless accreations that cause all the nuisance. We are not trying to attain anything. On the other hand, we are trying to give up everything.

Q.: Should I not try to attain Realisation of the Self?

B.: No. Give up everything. Only the Self remains.

Q.: It sounds simple enough. Yet, only one in a million men manage to reach this supreme state, according to Sri Krishna. Does it mean that, at any given point of time in the world, the number of Jnanis living should be a precise 0.0001% of the total population?

B.: [laughing] Possibly!

Q.: In my view even this seems an outlandish estimate. Are there now circa 269 Jnanis living in India, then, regard having been had to the numbers available by the 1931 Census?

B.: [somewhat mordaciously but without deviating from his good cheer] Why not? Do you suppose all Jnanis are unfortunate enough to be put in a cage like this, and put up for ‘public examination’? [in English:] Ladies and gentlemen, presenting… THE FREAK SHOW! Exhibit No. 1 – Sharji, the Venus of the Hottentots! Exhibit No. 2 – Elephant-man Merrick! Exhibit No. 3 – The ‘Bhagawan’, Ramana! அ என்ன பாழாகப் ேபான பகவானே◌ா [Tom: What a waste, O Lord] . No. Only those whose prarabdha is destined to be exceedingly miserable suffer like this! Sri Gandhiji has written, ‘The woes of Mahatmas are known to Mahatmas alone.’ [laughs heartily]

Q.: Other Jnanis, who, according to Bhagavan, enjoy a better prarabdha – they would be meditating in solitary places such as inaccesible jungles and caves, well away from habitable zones of humanity, I presume…

B.: You may presume whatever you like, no doubt…

Q.: So I am wrong?

B.: It all varies according to prarabdha. The Jnani is unfazed by what happens to the body. He has nothing to do with it. He has no localised consciousness functioning from within it. Killing it cannot harm him. Torturing it cannot affect him. He is absorbed by the Beyond, and quite lost there – for good. He may have 4 wives and 32 children. He may be running a busy household with dozens of mouths to feed. He may be employed on both day and night shifts of duty. Or, again, he may be sitting in an inaccesible cave with sensory organs in an inactive state, body rotting. It may be either way, but all this can be only from the point of view of the onlooker, since action is altogether alien to the Jnani; he himself knows nothing, sees nothing, does nothing. He has quite perished. Only a Jnani can tell who is a Jnani.

A person might look like a simpleton, yet he might know himself as the immortal Self. Another may display an unending spout of vedantic learning, yet his mind may not in the least have subsided. In this topsy-turvy world, which must needs always judge by its usual yardstick of ‘doing’, it is the latter who is generally extolled as the genuine case. The result? Misery for all involved. People cheat themselves into believing that they are in the vicinity of a great Mahatma. The pretender eventually himself foolishly comes to believe that he must indeed be a great Jnani, since so many people praise him day and night. So his ego becomes bloated; as a consequence he lands himself in all sorts of unpleasant situations. So, display of vedantic learning may cause a great very many problems for all involved. It is best to keep quiet.

Q.: Bhagavan said a Jnani may have numerous wives. Polygamy is a sin as per Hindu dharma. Can a Jnani sin, then? As far as my knowledge goes, the Manusmriti allows taking the next wife only if the existing wife or wives are mentally ill, infecundous, or unable to participate in rituals for the departed ancestors.

B.: What the Jnani does is always right. This does not mean that a man is morally excused in pretending to be a Jnani and then conveniently committing all sorts of crimes.

Q.: But how to tell who is a genuine Jnani?

B.: Only by yourself becoming lost in Jnana. However, there is one exceedingly rare exception. If a particular Jnani is destined to be your Jnanaguru, when you meet him there is an inexplicable mutual outpouring of ecstatic Love. The Love mentioned here is not consummated by any physical act. It is consummated only by surrendering to the object of such Love. The Jnani himself never loves or hates; only, when he meets one who is destined to be placed in his ultimate care, he directs his attention toward that person. It is not volitionary, but rather Automatic Divine Activity. There is nothing in him left to choose. Unto one who has the pakkuvam [Tom: ripeness], the Grace or Love begins to flow of its own accord. The Jnana-guru might not look at the mature devotee or exchange words with him, yet, one who is Ready feels the irresistible onslaught of inevitable rapid mental introversion in the form of blissful divine Love. This way you can tell that the person in whose presence you have such experience, is your Jnana-guru. Again, this might not happen in the case of all aspirants.

Q.: I have so far not had any such novel experiences with Bhagavan. Can I still Realise in this lifetime?

B.: All will turn out Right in the end.

Q.: Sometimes Bhagavan does not look at visitors. He does not respond to their queries. Does he refuse them his impartial Grace?

B.: Have you seen how they seperate chaff from the Grain here? They pour the seeds on the றம◌் , and then trenchantly shake it in a speedious upand-down motion. Can you guess the scientific principle underlying the act?

Q.: What is worthless and light in weight is blown away by the wind. What is precious and heavy is not affected by the movement. Yes, it is clear now.

B.: நல்லத◌ ! [Tom: good]

Q.: One imagines things and enjoys them by virtue of his strength of imagination. It is said that gross manifestations of such mental creations are possible for Brahma the Creator. Should the same power not be available with His creation, man?

B.: That is your opinion.

B.: J.K. says that man should try to find out the ‘I’. Then ‘I’ dissolves away, being only a bundle of circumstances. There is nothing assertible behind the ‘I’. His teaching seems to be very much like the Buddha’s.

B.: Yes. The truth is well beyond possibility of conceptual expression or explanation. It is pure Experience only, for there is no experiencer. When you finally do reach the Self, you will be shocked to discover that you have been foolishly searching frantically for something that was always right in front of your nose – no, even closer, for the nose and the object in front of it must be seen with the eye to ascertain their apparent existence, whereas the Self requires no perception to support its actual existence. The Self is pratyakshasakshathswayamprakasha-swaroopam. Everything shines in and by its light, but it knows nothing but itself. It shines by its own light alone. The lusturous beauty of it never fades. It is truly immutable, indestructible and imperishable. One who loses himself in it has no more cares or worries. It is the one true goal of man’s life, yet it is here and now. That is the great mystery.

Ramana Maharshi: Q. How to surrender and how to live and survive if we have completely surrendered? Partial surrender vs total surrender | Aham Sphurana

3rd August, 1936

Q.: After conversing with several devotees here, I have arrived at a rough observation that Sri Bhagavan gives spiritual advice which pertains to every conceivable genre, depending upon the inclination, maturity or palate of the aspirant in question. What, if any, is his nativistic teaching?

B.: [no response]

Q.: Is it Silence?

B.: Yes.

Q.: For those unfit to understand it?

B.: They are advised to keep quiet. [Summa iru.]

Q.: For those even this?

B.: The inquiry ‘Who-am-I?’ is suggested.

Q.: For those like me who lack the determination to practise this inquiry?

B.: Unconditional surrender.

Q.: To whom shall I surrender? To Sri Bhagawan or to my Guru Sri Chandrasekara Barathi of the Sringeri Mutt?

B.: Does surrender need a recepient? Simply surrender or let go of everything.

Q.: If I let go of everything, is Mukti assured unto me?

B.: To let go of everything is to let go of this question also.

Q.: So, expecting a reward for surrender is not appropriate?

B.: How can one who has surrendered expect anything? To surrender is to give up the spurious ‘you’ once and for all. When you are not there at all, where is the question of expecting or anticipating anything? Who would be there to do the expecting or anticipating? If there is still anyone left to engage in expecting or anticipating, no surrender has really taken place.

Q.: If I give up everything, what will happen to my body? How then will it be able to find food for itself, leave alone earn a living or maintain a family?

B.: Were you asked to neglect the body? You were asked to not deliberately take care of the body – that is all. How is it that you translate the directive, ‘Let go of everything.’ into ‘Neglect the body and its duties.’? The problem in its totality lies in the fact that you are labouring under the delusive impression that it is you as the ego who are maintaining your body, attending to your vocation, taking care of the household and everything else that it has fallen upon the body’s prarabdha to execute in this lifetime. So, when asked to give up everything, that is to say give up the ego, you give yourself to understand that your regular routine will come to a standstill.

No. Whether you are aware of it or not, whether you like the fact or not, the truth is that it is the Higher Power that does everything. We imagine ourselves to be the doer. When asked to give up the personal self, we imagine that the body’s actions also should come to cessation, because according to us, it is the personal self that is the cause and source of all action. No. It is a mistake. The ego merely fraudulently assumes responsibility for the actions of the body. Doerless doing or actorless action is not for the Jnani only; it is true – as an actual fact – in the case of all. In the case of the ajnani, something called “I” rises up to falsely claim responsibility for the body’s actions. This fictitious accreation is absent in the case of the Jnani. That is the only difference between them.

If you give up the ego or ‘Body-am-I.’ idea completely, some power effortlessly takes over the body and makes it run through its ordained course of prarabdha without the need for the least mental involvement or participation on your part. This is a matter for experience. To surrender is to totally let go of everything. People attached to concepts of the intellect or things of the world cannot possibly let go; vairagyam is necessary to let go. How to cultivate vairagyam? Proximity to the Guru.

Worldly attachment and the Guru pull the mind in opposite directions. If Love for the Guru is unequivocal and unconditional, His pull eventually wins. Again, how to cultivate this Love? By nature the minds of most men are occupied with the problems of the personal self. What vocation shall I pursue? Shall I study further or shall I opt for employment? Shall I marry the girl I like, or shall I marry the other one, the rich, obese character that I was introduced to by my parents? What measures shall I take to safeguard myself from penury in old age? How shall I ideally invest my wealth so that it stands me in good stead when I am no longer in a position to actively work to earn a living? Will my children take care of me in old age or will they abandon me and go their seperate ways? And so on and so forth.

This is how lifetime after lifetime is wasted. If you would only keep quiet without thinking these thoughts, providence would admirably take care of you; but no, you must have your ‘knowledgeable say’.

It so happens that in rare cases a man ceases to take thought of his personal self and wholeheartedly gives himself to an ideal of beauty, be it sport, literature, art, patriotism or anything else. The quantum of importance attributed to the personal self becomes negligible when the loftier pursuit occupies the whole of his attention. Thus he begins, for the first time, to experience a Love in which the personal self has no space. Such is the sweetness of this passionate Love that he yearns to experience the pinnacle thereof. The desire for this feeling of Love is not motivated by the objective of personally experiencing it. The Love for the higher ideal eventually comes to dominate and possess the soul with such complete fervour that his desire for such Love is not on account of any motive to personally experience it, but simply for the sake of such Love itself.

He does not think, I must experience more of this Love. He thinks, this Love must shine forth with the utmost possible intensity! Then, the ideal towards which Love hitherto had been directed merges imperceptibly into Love itself. Thus, the man is left with Love and only Love in his hands: Love without rhyme or reason.

Feeling it but unable to attain it, he becomes crazed with longing. It is at this stage that God or Guru appears to him as the manifestation of his Love: the manifestation may or may not be an anthropomorphic form; it may be an abstract image or ideal altogether deviod of form or even name. Eager to consummate his Love, he surrenders totally to the Guru and Realisation devours him by operation of the Guru’s benevolent grace.

Swami Vivekananda has said, ‘Take up one idea. Make that one idea your life – think of it, dream of it, live on that idea. Let the brain, muscles, nerves, every part of your body, be full of that idea, and just leave every other idea alone. This is the way to success.’.

So, volitionless Love, which, allowed to wax indefinitely, surely leads to Kaivalyam, may as well come to an inveterate materialist or atheist: belief or faith in God is not of any considerable importance, for it stops at the level of the intellect – it is Love that matters, uncaused, blind, mad, unconditional Love. In the work The Pilgrim’s Progress by John Bunyan, when Christian is about to drown in the dreaded river of Death, he has a vision of the Christ who reminds him of the verse: ‘When thou passest through the waters, I will be with thee; and through the rivers, they shall not overflow thee…’. The next moment the Christian finds steady ground to stand upon, and he manages to ford the remaining strech of the river safely.

Likewise, when Vasudeva was travelling to the house of Nandagopa and Yashodha, carrying the infant Krishna in his arms, the Yamuna river was in full spate, ready to devour him should he behave so unwisely as to step into it. Vasudeva thought of God and was immediately assisted by the giant 10-headed celestial serpent, Vasuki; thus he managed to ford the flooded river without incident.

Again, when Sri Abbanacharyal heard the news that his Guru, Swami Raghavendra, was about to enter into his brindavanam, he forthwith rushed to Mantralayam, but did not know what to do when he was faced with the flooded Tungabhadra. He gathered courage, closed his eyes, thought of his Guru, and threw himself into the raging deluge. He was not swept away by the river, but landed safely on the other bank.

How did all this become possible? Is not genuine Love for the Lord on the part of the devotee the reason? Thus, develop a deep obsessive infatuation with any particular ideal, and of itself that will plunge you into unfathomable Love; such Love invariably leads to Kaivalyam.

Q.: I am too weak to surrender, in the total sense of the term that I find Bhagawan suggesting. Also, I do not feel attracted to any one particular ideal or idea. What am I to do?

B.: It is holding on or doing anything that requires strength. If you feel you are weak, letting go of everything should be very easy, for that alone is non-doing.

Nevertheless, if total surrender is found too hard, practise surrender as a sadhana. This is called partial surrender. In course of time it leads to complete surrender.

Q.: Various descriptions of God are given by scriptures belonging to the different religions. Which is the description that tallies with Bhagavan’s teachings?

B.: Words cannot convey the Real. Yet, the closest is, Ehyeh asher ehyeh.[Tom: Hebrew, from Exodus 3:14 meaning ‘I am that I am’]

Q.: What is the difference between attempting on one’s own to Realise the Self and taking the help of a Guru?

B.: Suppose you want to go to America. Which is the sensible method? Taking a spade in hand and digging into the Earth, saying, ‘I am confident that I shall eventually reach America, which must be located on the exact other side of this very spot.’ or booking a place for yourself on the next outbound steamer?

The above excerpt is taken from Aham Sphurana, 3rd August 1936, see here for more information on this text.