Non-duality

O Bhagwan, Amidst your Eyes lie the Immortal Ocean – a Poem by Aman

~ Tom Das ~ Leave a comment

The following is a poem written by Aman, an attendee at Satsang, and this is shared with their permission:

O Bhagwan,
Amidst your Eyes lie the Immortal Ocean,
The Self that I am,
Which revealed itself in the Luminous rays of Your eyes,
May the waves of Love drown me deeper,
May all objects dissolve,
Revealing You alone that is Real.

O Bhagwan,
Gently lying covered in loin cloth,
Which is like a single look from the Sun,
Revealing the Light of my Being;
All multiplicity begins to vanish,
And that Love alone remains.

The mind seeks constant experience,
Arrive and dwell in the Ocean that needs absolutely nothing.
Reveal me as The Absolute,
The pure existence that alone is Truth,
The pure consciousness that is the substratum,
Which reveals no objects existed,
The pure limitless fullness,
The nectar of infinite light.

O it is the splendour of Your sun
Which fills my being with its vastness,
Dissolving all trace of myself
Lost within this illumination,
The splendour of Bliss,
Revealing It alone exists

The cave of the Heart,
Dissolution of the I-thought,
Absolute Consciousness
All things become inert;
What seemed like a mirage,
Merely droplet of sweetness upon the tongue of limitless Nectar,
Nothing compares to Thee;
What appears other,
Merely the fancy of the mind,
The imagination’s finite copies dreaming

But who dreams?
Who sees objects?
And all at once
It starts to be only Bhagwan

Take me where
Nothing was created,
Nothing existed,
Nothing needed to happen,
Beyond time,
Beyond conception,
Do you feel this Serenity?

Infinite Love so fulfilled
And in Bliss;
Why would stirring, movement, or creation have to occur?
The Nectar of Peace,
The ocean that rests in tranquility,
The hum amidst the Silence.

Om Shanti Shanti Shanti Om

Om Namo Bhagavate Sri Arunuchala Ramanaya Om

Ramana Maharshi: How to rid oneself of the ‘I am the body’ idea? | Manonasa | Aham Sphurana

~ Tom Das ~ 1 Comment

The following is taken from the text Aham Sphurana, 19th September 1936:

Questioner: In ‘Ulysses’ we find Mr. Joyce to have deployed the words, “And we stuffing food in one hole and out behind: food, chyle, blood, dung, earth, food: have to feed it like stoking an engine.” I am frequently beginning to think on such lines now-a-days. We feed and clothe the body; we find for it a warm shelter to live under. In return, what is our gain? The body keeps getting new diseases and fills us with agony and misery by putting us in pain. This is a traitorous body which returns evil for good. I don’t want it anymore. Is the body a gift from God? Is it a sin to refuse to remain in acceptance of it anymore?

Bhagavan Sri Ramana Maharshi: It is not so easy to get rid of the body. Physical annihilation of the body might remove it from this earthly realm, but again your mind will find another body for you. The body was manufactured only by the mind. There is only one way to kill the body: that is to kill the mind. Mind dead, not only does the body die, but also the whole of the cosmos. Our effort must therefore be directed toward killing the mind, not the body.

[Tom: Bhagavan is stating that it is the mind, also known as ego or ignorance, that ‘manufactures’ or creates/projects the body as well as the world and entire cosmos. If we merely kill the body, the mind will project a new body to inhabit, so samsara does not end. However, if we kill the mind, that is realise the self and thereby destroy ego/ignorance, then all that will remain is the worldless formless Self]

The body is not a gift from God inasmuch as God never asked you to take the form of the body – i.e., to imagine that you are one and identical with the body. You ask what is gained by holding on to the body. Who is it who says he is holding on to what he refers to as being his body? Discover the identity of that villain. Then you Realise that you never did have any body. The body has nothing to do with you.

You are bodiless always. Realise It. How? The same Mr. Joyce mentioned by you also writes, “…remember, my dear boys, that we have been sent into this world for one thing and for one thing alone: to do God’s holy will and to save our immortal souls. All else is worthless. One thing alone is needful, the salvation of one’s soul. What doth it profit a man to gain the whole world if he suffer the loss of his immortal soul? Ah, my dear boys, believe me there is nothing in this wretched world that can make up for such a loss.” If the soul is immortal how can it be lost? So, what is attempted to be communicated? The Immortal and Imperishable Soul is seemingly lost because of avarana [Tom: the veiling power of tamas]. That is the meaning. To tear asunder this veil of iniquity is the one and only relevant goal of one’s life.

Q.: And it can be accomplished by asking oneself, ‘Who am I?’?

B.: People who come here say, I practise the investigation ‘Who am I?’ for an hour each day, or for a few hours each day. What can we say to them? It is not a practice that is to be pursued a few hours each day. It is a fundamental change or shift in the direction in which one’s extroverted mind happens to incumbently be oriented. Relentlessly pursue the investigation day-in and dayout till the Self is Realised.

Q.: How can the investigation, which seeks to curb thought, be at all combined with activities that necessarily entail thinking?

B.: With persistent practise of the practice, activities – that you now think are being done by you – will automatically go on effortlessly. Your intervention will then be unnecessary – in fact, impedimentous. We are under the impression that we do things. What is the fact? It is the Higher Power that does everything. Is it the chiselled figures found at and forming part of the base of the Rajagopuram that bear the weight of the same? Is it not the earth that bears the entire load? Yet those sculpted figures have facial features that are wildly contorted with the evident strain of carrying the huge structure. It is a clever, artistic sham. Likewise here. The ego never does anything, but simply appropriates to itself credit for the body’s actions, which happen exclusively and spontaneously in accordance with Ishwara’s pre-destined script for it.

In other words, thoughts do not cause action to take place. Actions always go on only of their own accord: only we assign to them a spurious sense of personal doership or individual agency, and suffer thinking that free-will is real.

Q.: But actions follow thoughts. First I think and decide; then I act accordingly.

B.: That is just what is NOT true.

Q.: How so?

B.: The apparent causal-synchronicity between thought and action is a sham. That alone transpires which is destined to transpire. The preceding thought motivating the [body’s] action is not the result of free-will. Why? Because there is no such thing as free-will. How then is there cohesion between thought, which occurs first, and action, which occurs in subsequent concatenation? It is because the extroverted mind is also subject to destiny, just as the body’s actions are subject to destiny.

Q.: How cheerless to think that free-will is a myth…

B.: It cannot be denied that from the standpoint of the individual person free-will is indispensable. But where is the need to be an individual person when you can BE THAT?

Ramana Maharshi: Jnanis and Avatars – Aurobindo, Meher Baba, Krishna, Jesus, Buddha | Ask and ye shall receive Aham Sphurana

~ Tom Das ~ Leave a comment

The following is taken from the text Aham Sphurana, 7th July 1936. Please see here to find out more about this text:

Questioner: Yes, some say Aurobindo is the Avatar of the age, while others say it is Meher Baba; still others say it was the late Sai Baba. Yet others maintain that Sri Krishna was the last Avatar in the Anthropomorphic form, before Kalki Avatar arrives at the time of Cosmic Dissolution. For others it is Buddha, Ramakrishna or Confucius. Will Bhagavan tell us in what way His experience of consciousness is superior to that of these, since, allegedly, they seem to be mere Avatars, and not Jnanis? And really who is the Avatar corresponding to this Era in Mankind’s history, a particularly tumultous one – Germany has announced her intention to rearm herself, an indication of the belligerent attitude of the National Socialist Government? Surely an Avatar is necessary from age to age to look after the world to ensure that mankind’s evil-doing collectively remains lesser than his acts of benignness? Jnanis do not act in the world, except to ensure the merest existence of the physical body, is that not so? So, where is the Avatar who is going to look after our poor mortal selves- and also the world?

Bhagavan Sri Ramana Maharshi: Experience of Consciousness, if genuine, naturally precludes ‘others’; thus there is nothing superior or inferior, because there is no second, no other, nothing foreign or alien to or apart from the One Immutable Absolute Self – so the question of comparison is, simply, nullity.

All True Masters are ONE, not because they identify themselves with something in common, but because commonly the faculty of identification [of one thing with another] does not exist in any of them. As for Avatars, each one sees an Avatarapurusha [Tom: purusha means person] according to his own mental convictions and predispositions – to establish the finality of one’s own viewpoint admist others will result only in fruitless skirmishes. You may continue to believe in whatever pleases your own fancy, but expecting corroboration from others for your weltanschauung [Tom: world view] of the universe will serve only to increase your sense of mental unrest and agitate the mind further.

Q.: So the idea of the Avatarapurusha, God-manifest/God-incarnate, who comes down from age to age, is just… a fallacy, only as good as a fairy-tale? Do not the Holy books of the various faiths speak of these blessed beings, whom we might worship – since manifestation makes available a form to worship – so that we might elevate ourselves to the zenith of spiritual perfection and purity, puissance and divinity? Jesus, Mahomet, Zoraster, Buddha – what about them? Specifically does not Krishna say, parithranaya sadhunam… etc.? How can these considerations be ignored?

B.: Your mental predilections and proclivities foist upon you the erronous idea that there is a God outside your Self, and that He sends down messengers to guide you and show you the way to reach Him. If you keep on journeying, you will never reach. Therefore, I say, enough searching – call off the search and be yourself, nothing more. The great masters – each in his own tongue, but each from the same Heart – yearned to give you this message only – BE YOUR SELF.

The Masters you mentioned, and others, each doubtless had – and has and continues to have always – his specific, special or unique role in man’s spiritual evolution, but the zenith spoken of by you will certainly not be reached by discussing the question, ‘How can all of these Mahanubhavars be right? On what points do they contradict themselves? Is it not our imminent task-on-hand to clear up these apparent contradictions and seeming mutual inconsistencies? Will that not endow us with special spiritual merit?’ Men waste entire lifetimes – fruitlessly – like this. This effort, if harnessed fully to keeping one’s Latchiyam [Tom: aim or target or goal] fixed entirely on Self or Reality, would have resulted in Mukthi long ago. Instead, countless lives have been frittered away on account of these wrong and foolish ideas about reaching Truth by using the Buddhi or the resoning faculty, when, in fact, precisely subsidence of that faculty results in revelation of Self or Reality. What a pity.

Q.: It is still not clear. The Avatara Purusha – is he just a mental concept like the gandharvas, rakshasas, bhutas, etc.? Has not this tangible world witnessed the advent of many such great men, Bhagavan himself not excluded?

B.: The trouble arises when we use their teachings to satisfy our intellectual palate and appetite. To the unwise, it does not occur to try and practise, instead of using it as a subject of discussion at gatherings of philosophers and metaphycists.

Therefore I say – Do not try to write essays on it. Do not try to present articles of great erudition on it. Do not try to gain followers for your newly discovered maxim or device-of-apotheosis or precept-of-ancient wisdom. Do not conceptualise it mentally and then, getting trapped in those very concepts, moan and complain that you ‘see no progress’. Do not go on discussing or talking about it. Do not tell yourself, ‘First I shall obtain intellectual mastery over the technique and subsequently shall begin the application thereof.’

Instead – plunge into the practice HERE and NOW; stick to the teachings of any one Mahanubhavar, and all will come right in the end.

Masters are there only to show you the way – man fogs the fulfilment of their purpose by merely theorising or intellectualising about their respective lives, advents and teachings, such as asking – Is this one or that one a Siddhapurusha, Muktha-purusha or an Avatara-purusha? Of course these are your mental concepts only. In fact, the Master, being not at all different from the formless Absolute seated in the tabernacle of the Sacred Heart of Man, is really synonymous with your own True Self – why seek him anywhere else?

Q.: For myself I am now convinced, but I am worried about the hopeless spiritual condition of the world, which seems to be enveloped in profuse darkness. When will all the people of the world wake up to the fact that they are living in the ghastly darkness of ignorance, and understand that the world around them is a dream, so that they can obtain genuine illumination? What about those unfortunate ignorant millions of the world, who have never met a genuine Sadhguru in their life? Supposing their prarabdha-karma dictates that they spend the entireity of their lives being relentlessly tossed around in the evil sea of avidya maya, as a result of the Guru’s accquaintance never coming to transpire- what then? For how many lifetimes more will their ordeal of ignorance have to last, and when at last would such unfortunate ones meet their Guru- so that through Him their redemption could be vouchsafed for certain? Such unfortunate persons, never having had the extreme good fortune of meeting B. during his blessed sojourn on this Earth, which, owing to his stay here has become itself a sanctified land, must needs count themselves exceedingly unlucky- what, therefore, would Bhagavan have them do? What can they do? What will be their fate?

B.: The fate of each one depends upon his merit. Take care of yourself and others can take care of themselves.

This answer was evidently not to the questioner’s liking. He seemed to toy with the idea of placing forth additional arguments before Bhagavan as to why mercy ought not to be showered in profusion upon the ‘ignorant’ masses of the world, until Chadwick pacified him with the following words:-

“Bhagawan has said that when longing for God or intensity of meditation has reached a feverish intensity/pitch, the Guru automatically manifests before the devotee.”

Even then, the man seemed about to say something, when the Hall’s attention was riveted by Bhagavan’s voice suddenly reading from Scripture the words of a Jewish Carpenter no less a genius in the realm of Spirit, the heartthrob of many a lonley, man-forsaken soul yearning for Divine acceptance –

“Ask, ye shall receive; Seek, ye shall find; Knock, it shall be opened unto thee.”

Ramana Maharshi on Aurobindo’s Intergral Yoga – bringing Divinity back down into the world after Self-Realisation | Aham Sphurana

~ Tom Das ~ Leave a comment

The following is taken from the text Aham Sphurana, 7th July 1936. Please see here to find out more about this text:

Questioner: I am aware that Bhagavan is a solipsist. However, to dismiss all human problems as being imaginary requires a giant leap of faith towards the Idealism end of the spectrum.

Bhagavan Sri Ramana Maharshi: It merely needs disillusionment with materialism.

Q.: According to Sri Aurobindo’s claims, he has probed beyond the experience of the Vedic Rishis. What is Sri Bhagavan’s opinion? Is it authentic or not?

B.: Aurobindo’s talk of bringing down divine consciousness from above overlooks the same being already Self-effulgent in the Heart. Reality simply IS. Where arises the question of moving it from place to place, etc.? People keep asking me about Sri Aurobindo’s yoga system; and if I give my reply according to my capacity, they go away disgruntled saying, “These Jnanis are always contradicting each other.” What can I do?

Q.: What about Sri Aurobindo’s claim that one must commence from Self-Realisation and then proceed to bring down the Divine to the Earth?

B.: Let us first Realize and then discuss, if need be; not now.

[Tom’s comments: Sri Aurobindo’s view was that once the truth was realised, it should be ‘brought back down’ into the level of the world, in what he called Purna Yoga or Intergral Yoga. Sri Aurobindo rejected the notion of Shankara or Vedanta that the world was unreal or ‘maya’, stating that the world is a real expression of the divine, and that the purpose of spiritual teachings is not nirvana or escape from samsara, but instead to enrich and enliven the lives of people here in this world and help people live divine lives here on Earth. Sri Aurobindo felt that the Vedic rishi’s had discovered the Truth, but had not learnt to or were not able to or even inclined to bring it back down to Earth, and that the notion of the world being an illusion was a result of the failure to bring the Divine back down to the Earth.

Here is a link to a chapter on Integral Yoga by Sri Aurobindo for those interested on these points, where he defines Purna Yoga and explains his view on the above points I have made: https://sri-aurobindo.co.in/workings/sa/37_28/02_004_e.htm

Sri Ramana in response to the questioner is saying how can Truth be ‘moved’ anywhere, let alone ‘back down’ into the world? ‘Reality simply IS’. The implication is that the very notion of bringing truth back into the world is based on ignorance or non-realisation of the actual truth]

Q.: What is the ultimate purpose of a man’s life?

B.: To find an answer to the question of “Why am I, apparently, limited to, and therefore by, a body? Am I nothing more?”. This question finally resolves itself into the question of “Who am I, who am apparently bound by this limitation of being or carrying a body?”. This much is certain: one who foolishly takes his bodily existence for granted, who thinks that it is an inevitable finality that he is, in fact, born, will never succeed in the Quest no matter what austerities or penance he might perform.

Only the Unborn can know the Unborn. The Unborn knows itself only – that is, it knows no birth or death. The intellectual understanding that the bodily existence is futile, undesirable, useless and delusory is the very first step towards Realisation. If you accept the existence of limitations [Tom: eg. if you accept or start with the premise that you are a body-mind entity, or that the world is real], any Sadhana performed will have precisely only one result – it will make the Ego grow stronger and stronger and stronger. One who wants to transcend limitation should cease to imagine himself to be limited – that will do; yes, it indeed is as simple as that. Instead of simply giving up the unreal, people want to do Sadhana to eradicate it! Is it not funny?!

Q.: Is Sadhana not useful?

B.: Only if it is done without assuming the existence of limitations. The only useful Sadhana is the investigation “Who am I?”. Everything else is just “release-of-concept-gas” [movement of mental ideas or churning of vrittis within the mind], because existence of limitations is implicitly assumed and accepted. If non-existent limitations are accepted to exist, how can any Sadhana performed on the basis of that wrong acceptence have any use, and how can such spurious Sadhana help you transcend those very limitations?

Q.: The logic seems to suggest that the Self can be discovered by the mind.

B.: The dead mind becomes the Self or discovers itself to be the Self.

Q.: I understand Nietzsche talks about the concept of Eternal Reccurrance of the same in Also sprach Zarathustra. Does B. agree with it? Each time the universe is recreated after the cosmic dissolution, does it exactly repeat itself? If that were to be true, both free-will and Self-Realisation would be impossible. If everything is going to unfold now exactly as it did previously, my incumbent free will is obviously just a myth. If everything is going to unfold in exactly the same manner in the future as now, I am never going to escape from the cycle of births and deaths!

B.: All these are only mental concepts. Even now you are not born. Realize it.

Q.: The body was born.

B.: Are you it?

Q.: It is part of me – Bhagavan’s teachings tell me that I am Brahman and therefore immanent everywhere.

B.: Leave Brahman alone. Talk about yourself first. Who are you?

Q.: I really don’t know… I am Pure Consciousness, is it not?

B.: Is Pure Consciousness now conversing with me? Is it is saying, “I am Brahman.”, etc.?

Q.: Then what is the answer?

B.: The effortless thought-free state is the answer.

Q.: How to attain it?

B.: There is no question of attaining anything. BE – don’t ask how to be. It is your very nature.

Q.: I am unable to realize it.

B.: This is also only a thought. Get rid of it and all will be well.

Q. I have heard of the Jnana-vichara technique expounded by Sri Bhagavan. How could asking oneself the question ‘Who am I?’ lead to transcendence of mind, when asking the question itself is only an activity initiated and sustained on the level of the mind?

B.: The vichara begins with the mind and ends in the Self. Mind turned fully inward discovers itself to be the Self.

Chadwick was asked by Bhagavan to give the man Bhagavan’s ‘Who am I?’ to read. He read it and then asked –

Q.: I find it shocking to consider seriously Advaita’s proclamation that the Jagrat state [Tom: waking state] is nothing better than a dream. It amounts to saying that I am now dreaming whereas I believe to the contrary, that whatever I am experiencing through the senses exist independantly of my perception thereof… How is it that the numerous disciples of yours – or followers or devotees or worshippers or afficionados or whatever it is that one would be justified in calling them take gladly to the idea that the world – the same world they experience everyday – is a dream?

B.: You say it is the same world you saw yesterday that you are seeing today. How do you know that? Through memory. Memories are also illusory. They create a deceptive fabric of intellectual continuity where in fact none exists.

What actually exists is only Beingness or Self. Even in dreams you have memories, go to familiar places, etc. How is it? Jagrat or Swapna, the same mind draws the poisonous veil of objectification or differentiation over the pure Self, hiding it. This veil is called the screen of avidya maya. Don’t ask, who cast this veil? Instead, ask, who sees the veil? Then you will see there was never any veil. This is called Self-Realisation. The desire to do sadhana to attain it is itself meaningless because it presupposes the existence of someone apart from the Self who is doing Sadhana to reach the Self.

Q.: Is it the realisation you speak of as Sahaja Nirvikalpa Samadhi? Should I not do any Sadhana? Is Sadhana useless then?

B.: Yes, it is the same realisation. Sadhana is the means to gain the Self. Only the idea “I am doing Sadhana” renders the Sadhana totally pointless and useless. Sadhana becomes natural if attraction to worldly pleasures stands removed. Desire for worldly pleasures take to their heels when you realise the world is only a dream.

Q.: I still find it impossible to believe this solid world could only be a mere dream.

B.: [smiling] Two different categories of spiritual aspirants or sadhakas exist. One is the Spülauftrag [Kritopasaka] and the other is the Wischauftrag [Akritopasaka]. [Bhagavan sometimes used words in the questioner’s native tongue to drive the impact home, or where technical terms were involved.]

[Tom: Kritopasaka refers to those who have done sadhana previously, eg. in a previous life, and so who are mature seekers, akriopasaka is the opposite; Spulauftrag (‘rinsing task’) means that task which only needs to be washed or rinsed, whereas Wischauftrag (‘wiping task’) refers to a task in which some wiping or scrubbing is first required before rinsing/washing can take place]

The former is born with the intellectual conviction, born of aeons of serious and steadfast spiritual practice directed along the correct channel [that of making the mind turn Selfwards or Sourcewards], that the cosmos he sees around him is the merest of illusions, and that expending one’s mental faculties upon it would be the ruin of one’s inherent nature of abiding peace and unshakeable happiness; whereas the latter is shocked and unsettled when informed that there is no difference – for all practical purposes – between the Jagrat [Tom: waking] and swapna [Tom: dream] states.

The firm intellectual conviction that the perceived cosmos is seen, owing to delusion, as being constituted by multiple disparate entities while the truth is that it is vested in the same Substratum, Adhishtanum [Tom: substratum], or Sadhvasthu [Tom: Sad = true or real; vastu = thing or substance or reality] as the Seer, is born only as a result of arduous spiritual practice which is possible only if the Sadhguru’s abundant Grace is available as a catalyst, which Grace descends unto him alone who perpetually bathes his heart in the effulgent glow of unselfish and non-reciprocation-expecting love of God, Humanity or any other single-minded ideal of pure, ecstatic devotion or parabhakti, and this intellectual conviction [as to the world’s objective unreality] is the seed of Jnana that grows into the tree that chokes the poisonous weed of Egotism or Ahankara at its root, destroying it once and for all, such seed having been planted long ago in the fathomless, dark misty depths of the mind by way of the Supremely merciful glance of Grace of the infinitely compassionate Sadhguru.

Q.: So, the widely held perception that without a Guru, even Atmajigyasa [Tom: the desire for self-knowledge], leave alone Atmasakshatkara [Tom: Self-realisation], is totally impossible, is…?

[he left his words trailing in the air, for the Sage to rythimically conclude,]

B.: Unequivocally and absolutely correct.

Sri Ramana Maharshi – Q. If Ajata-Advaita is the truth, then why do you recommend Bhakti to some? LET GO OF EVERYTHING | Aham Sphurana

~ Tom Das ~ 1 Comment

Questioner: When Sri Bhagavan is actually of the opinion that Ajata-advaita is the only truth, why does he recommend Bhakti to some people who come here? Is it not doing them an injustice?

Bhagavan Sri Ramana Maharshi: What do you know about Bhakti?

Q.: I know that it posits duality by making the sadhaka [Tom: seeker] presuppose the existence of a personal God; whereas, according to Bhagavan, from the stand-point of Truth or Reality the personal God does not exist at all.

B.: When, as a result of supreme unconditional Love for God, the mind melts away without the slightest trace of residue, it is Realisation of the non-dual Self.

Q.: My question is why people are not being discouraged by Bhagawan from continuing their dualistic practices of ritual worship, when the personal God does not even exist according to the Ajata-advaita school, which is the system of philosophy endorsed by Bhagawan.

B.: Worship of name and form is also a means to Realise the Nameless and Formless, provided there is motiveless Love- that is to say, unconditional surrender.

Q.: How so?

B.: Obsessive fixation on any one particular thought to the exclusion of all else, is the way. The one who does Jnana-vichara asks himself ‘Who-am-I?’ every time a thought occurs. The thought disappears and he is re-absorbed into the current of pure consciousness. The one who yearns in fathomlessly intense longing Love for God severs thoughts as and when they arise, by telling himself that it is not for him to think thoughts in which his beloved finds no place. Always immersed in thoughts of his beloved, he speedily reaches the stage where it has become fully obvious to him that rather than think about his beloved and thus cognise him indirectly, he might experience his beloved directly by feeeling-contact, which is the same as self-immersion in the current of divine Love latent in the sadhaka always. Is this current different from pure consciousness? No. So, Bhakti or Jnana, the aim is the same: total destruction of thought. Only those desperate to escape from samsara, no matter what the cost or price might be, Realise; the others remain sadhakas.

Imagine you have fallen into a cataleptic condition caused by an unfortunate concussion to the head. You are mistaken for dead and deposited inside an opulent ebony-wood coffin. The exquisitely carved lid is nailed shut and you are lowered deep into the bowels of the earth. Next the earth is filled in, a monumental stela is erected over the spot, eulogies are read out and then everybody disperses. Minutes later you wake up and all the sensory information that your brain had been unconsiously registering all this while flashes in upon you in a moment. Being trapped in this situation, the same exact desperation you would feel then, if you are able to feel now for being stuck in samsara – for there is not much difference – Realisation is assured; else you may go on contentedly telling yourself, ‘Once I am done with these my toilsome wordly responsibilities, I shall focus myself exclusively to the cause of discovery of my true Self…’ or other similar drivel, life after imaginary life…

Have you seen fish captured in a net? The complacent ones become food, but some jump about so uncontrollably that they manage to fall back into the ocean. Likewise, Sri Ramakrishna describes a high-souled creature known as the Homa bird. For one who is wont to postpone Realisation to the future, this ‘future’ never arrives. Till he goes to the grave, one concern after the other occupies him. Increasingly frustrated, each time he tells himself, ‘Immediately after solving this problem I shall be in a position to commence my steadfast sadhana, which even the heavens will not be able to shake…

But let me wait until this one last fleeting problem is solved, for I do not want anything else to occupy my attention once I have commenced my assiduous sadhana…’. Invariably, once one problem is over the next reveals itself soon after. It is like chasing your own shadow when the sun is behind you. Can you ever catch it? Therefore, Realisation is in the here and now. When Hanuman was asked what day of the week it was, he said, ‘Brother, I know naught about these things. To me only Rama exists.’. So, that is the attitude of the ideal sadhaka. Mundane matters do not succeed in gaining access to his mind. Yet he may be impeccably discharging countless professional and household duties. The onlooker might think, ‘Oh! poor man. What an encumbered life is this!’. In fact one who has altogether surrrendered is not doing anything.

Q.: Should not one try to discover one’s true Self by the dint of one’s own efforts, rather than soliciting the assistance of imaginary deities, who really do not exist at all, according to Bhagavan’s teaching?

B.: If you are real in this body and mind they are too. You cannot be selective in your approach to the Truth.

Q.: My body is a tangible physical existence. The gods mentioned in the scriptures are not to be found anywhere.

B.: The one fiction is gross; the other is subtle.

Q.: How long should Jnana-vichara be practised?

B.: Until the natural state is regained. Consider this ancient story from Thracia:

Once upon a time, a hungry fox, seeing some bread and meat left behind by shepherds in the hollow of an aged oak-tree, stealthily crept into the hole and obtained for himself a hearty meal. When he finished eating, his stomach was so full that he was not able to get out. He began to groan and lament his fate.

Another Fox passing by heard his cries, and coming up, inquired the cause of his complaining. On learning what had happened, he said unto him, “Ah! you will have to remain there, my friend, until you become such as you were when you crept in; and then you will easily get out.”

So, without regaining the primal state of mind, escape from the infernal abyss known as samsara is not possible.

Q.: What is this natural state of the mind?

B.: Subjective-awareness-sustained-effortlessly-and-volitionlessly.

Q.: How can I not make an effort to do something and yet do it? It sounds quixotic and ridiculous.

B.: You are so used to doing that your true nature of restful non-doing has become alien to you. Since your departure from the natural state has plunged you into an ocean of unending activity, you are become quite alienated from your natural state of blissful inactivity. So you are framing the absurd question, ‘What can I do to regain the natural state?’. It is like asking, ‘In order for the maximum amount of light to be facilitated to spill forth from this lantern, in what position shall I hold my hand in front of the lens?’. If you simply take your hand away, the light shines clear and bright. So, let go of the ego, and the Self is revealed.

But people will not understand this. They want formulas, concepts, methods – in short, they want something they can ‘do’. Whenever they have wanted something in their lives, they have done something to obtain it, and probably succeeded. So they think Enlightenment can also be won this way.

Many charlatans also cater to the psychological requirements of such gullible people, prescribing mental exercises for them that plunge their minds into a state of delibrately sustained bliss; thus, the poor victims think they have successfully Enlightened themselves! [laughs] Alas, no! No amount of doing or ‘meditating’ can reveal the Self. The loftiest, most useful and most legitimate advice that can be given to an aspirant for Realisation is simply Summa Iru [Tom: ‘Just be’ or ‘be still’].

But people want a formula by means of which this can be acheived: therefore the Jnana-vichara is prescribed. One who is desperate enough in his want to Realise will not waste time in gossip; he will abandon everything; thus, only the Self remains.

Do not be attached to the body and do not aim at satisfaction of the never-ending requirements of the personal self; these are transient, illusory appearances in the One Real THAT. Whatever is born will certainly die. What is perishable is bound to perish. Why entrust your attachment unto something that is doomed to disappear one day?

Samsara is like a glowing red iron rod that one holds in one’s hand, wearing the glove of avidya maya. The evil power of avidya maya never allows the full might of the misery of samsara to impress itself upon your mind; nor is the pain withheld altogether. If you were to actually feel the full heat of the iron rod, you would instantly drop it, and avidya maya would be cheated out of her fun. So, the pain is given to you in manageable doses, so that you think foolishly, ‘Oh! this life is a mixture of happiness and sorrow.’; such an attitude allows the yearning for more experience of samsara to be still present in you.

One who longs for God with all his heart is helped by God in the following manner: the glove is forcibly ripped apart. So, one who is a devout Bhakta may sometimes have to face stupendous tragedies that may make people remark, ‘This is how God rewards his most sincere worshippers.’. This sarcastic statement is actually true in the literal sense. Whilst the glove is still on you can never be persuaded into dropping the red iron rod; once it is gone, discarding the furiously hot rod is inevitable, because, now, unlike before, the pain is too enormous to manage. ‘Totally letting go of all the mind’s contents’ is the only sadhana that is effective for Realisation, not ‘destroying the mind’. Mind, being fictitious, cannot be destroyed anymore than it is possible to kill a snake that one sees in a rope. When we talk of manonasha, it merely refers to a state where the illusion of the world is absent: that is all. How are you going to destroy what never was and what cannot be? If you want Realisation, all you need to do is this: LET GO OF EVERYTHING. In fact, all who have Realised have done only this in the end, having given up all sadhana to be useless skulduggery.

Q.: Is sadhana not necessary to Realise?

B.: The only genuine sadhana is to give up all sadhana. The aim of all practices is only to give up all practices.

[Tom’s comments: ‘give up all practices means to give up all practices’ together with the ‘I’ that is doing them; if only the former is given up, ignorance or the ‘I thought’ still remains, and this is not liberating]

The above excerpt is taken from Aham Sphurana, 28th July 1936, see here for more information on this text.

Q. Why are some of our prayers not answered? How to know if a Jnani is genuine? | Sri Ramana Maharshi | Aham Sphurana

~ Tom Das ~ Leave a comment

The excerpt below is taken from the text Aham Sphurana (see here to find out more about this text and download a copy for free), 20th July 1936:

Questioner: It happens to some that they pray – in all good faith – to God, yet their prayers are unequivocally repudiated. What is the reason?

Bhagavan Sri Ramana Maharshi: Can you be trusted to know what is best for you?

Q.: I should hope so.

B.: That is your opinion.

Q.: What then is Sri Bhagawan’s opinion?

B.: ‘O Lord, thou hast searched me, and known me. Thou knowest my downsitting and mine uprising, thou understandest my thought afar off. Thou compassest my path and my lying down, and art acquainted with all my ways.’

Q.: The implication being?

B.: He knows what is best for you; you do not. Therefore unconditionally surrender yourself to him and leave your fate in his hands. That is the only thing to be done. Prayer is merely a lower form of surrender. It is highly prone to failure, because if what is asked does not aid Realisation, it may not be granted, even though you may be thinking that what you are asking is going to [serve as an] aid in Realisation. Or, your karma may not permit the request to be granted.

Q.: Spiritually-inclined people pray for strength to inrovert the mind. Or, they pray for Self-Realisation. How can that be not an aid in Realisation?

B.: Because it posits the dangerous notion that there exists an [individual] “I” who craves for himself the state called Realisation. Such prayers are unnecessary. Maam Aekam Sharanam Vraja. ‘Only surrender to Me.’

Q.: Why does God allow karma to meddle with even the efforts of sincere aspirants who are trying to Realise?

B.: The arrangement of karma – [for karma itself is] unavoidable – is actually adroitly done in such a way as to give the sadhaka the maximum possible chance of completely cleansing the mind of all vritts. So, if you are destined to Realise in this lifetime, rest assured that your karma has been ingeniously arranged in such a manner as to inevitably take you to the Goal.

Q.: And if I am destined otherwise?

B.: Perhaps you would not be here today.

Q.: The same astute God who manipulates karma so carefully – why was he not careful enough to safeguard the Self from slipping into the bondage of ignorance?

B.: Does the Self complain of having thus fallen?

Q.: No. But I do.

B.: Are you apart from the Self?

Q.: The mahavakyas state that I am supposed to be one with Brahman.

B.: And your Experience is in Corroboration?

Q.: Alas! No. All I feel is the miserable ego.

B.: Yes. Misery is one with the ego. Kill the ego.

Q.: It seems to be an impossible accomplishment even for those with decades of systematic training in the spiritual field.

B.: There is no accomplishment possible. What is intimate and inherent cannot be accquired. The only thing to do is destroy the useless accreations that cause all the nuisance. We are not trying to attain anything. On the other hand, we are trying to give up everything.

Q.: Should I not try to attain Realisation of the Self?

B.: No. Give up everything. Only the Self remains.

Q.: It sounds simple enough. Yet, only one in a million men manage to reach this supreme state, according to Sri Krishna. Does it mean that, at any given point of time in the world, the number of Jnanis living should be a precise 0.0001% of the total population?

B.: [laughing] Possibly!

Q.: In my view even this seems an outlandish estimate. Are there now circa 269 Jnanis living in India, then, regard having been had to the numbers available by the 1931 Census?

B.: [somewhat mordaciously but without deviating from his good cheer] Why not? Do you suppose all Jnanis are unfortunate enough to be put in a cage like this, and put up for ‘public examination’? [in English:] Ladies and gentlemen, presenting… THE FREAK SHOW! Exhibit No. 1 – Sharji, the Venus of the Hottentots! Exhibit No. 2 – Elephant-man Merrick! Exhibit No. 3 – The ‘Bhagawan’, Ramana! அ என்ன பாழாகப் ேபான பகவானே◌ா [Tom: What a waste, O Lord] . No. Only those whose prarabdha is destined to be exceedingly miserable suffer like this! Sri Gandhiji has written, ‘The woes of Mahatmas are known to Mahatmas alone.’ [laughs heartily]

Q.: Other Jnanis, who, according to Bhagavan, enjoy a better prarabdha – they would be meditating in solitary places such as inaccesible jungles and caves, well away from habitable zones of humanity, I presume…

B.: You may presume whatever you like, no doubt…

Q.: So I am wrong?

B.: It all varies according to prarabdha. The Jnani is unfazed by what happens to the body. He has nothing to do with it. He has no localised consciousness functioning from within it. Killing it cannot harm him. Torturing it cannot affect him. He is absorbed by the Beyond, and quite lost there – for good. He may have 4 wives and 32 children. He may be running a busy household with dozens of mouths to feed. He may be employed on both day and night shifts of duty. Or, again, he may be sitting in an inaccesible cave with sensory organs in an inactive state, body rotting. It may be either way, but all this can be only from the point of view of the onlooker, since action is altogether alien to the Jnani; he himself knows nothing, sees nothing, does nothing. He has quite perished. Only a Jnani can tell who is a Jnani.

A person might look like a simpleton, yet he might know himself as the immortal Self. Another may display an unending spout of vedantic learning, yet his mind may not in the least have subsided. In this topsy-turvy world, which must needs always judge by its usual yardstick of ‘doing’, it is the latter who is generally extolled as the genuine case. The result? Misery for all involved. People cheat themselves into believing that they are in the vicinity of a great Mahatma. The pretender eventually himself foolishly comes to believe that he must indeed be a great Jnani, since so many people praise him day and night. So his ego becomes bloated; as a consequence he lands himself in all sorts of unpleasant situations. So, display of vedantic learning may cause a great very many problems for all involved. It is best to keep quiet.

Q.: Bhagavan said a Jnani may have numerous wives. Polygamy is a sin as per Hindu dharma. Can a Jnani sin, then? As far as my knowledge goes, the Manusmriti allows taking the next wife only if the existing wife or wives are mentally ill, infecundous, or unable to participate in rituals for the departed ancestors.

B.: What the Jnani does is always right. This does not mean that a man is morally excused in pretending to be a Jnani and then conveniently committing all sorts of crimes.

Q.: But how to tell who is a genuine Jnani?

B.: Only by yourself becoming lost in Jnana. However, there is one exceedingly rare exception. If a particular Jnani is destined to be your Jnanaguru, when you meet him there is an inexplicable mutual outpouring of ecstatic Love. The Love mentioned here is not consummated by any physical act. It is consummated only by surrendering to the object of such Love. The Jnani himself never loves or hates; only, when he meets one who is destined to be placed in his ultimate care, he directs his attention toward that person. It is not volitionary, but rather Automatic Divine Activity. There is nothing in him left to choose. Unto one who has the pakkuvam [Tom: ripeness], the Grace or Love begins to flow of its own accord. The Jnana-guru might not look at the mature devotee or exchange words with him, yet, one who is Ready feels the irresistible onslaught of inevitable rapid mental introversion in the form of blissful divine Love. This way you can tell that the person in whose presence you have such experience, is your Jnana-guru. Again, this might not happen in the case of all aspirants.

Q.: I have so far not had any such novel experiences with Bhagavan. Can I still Realise in this lifetime?

B.: All will turn out Right in the end.

Q.: Sometimes Bhagavan does not look at visitors. He does not respond to their queries. Does he refuse them his impartial Grace?

B.: Have you seen how they seperate chaff from the Grain here? They pour the seeds on the றம◌் , and then trenchantly shake it in a speedious upand-down motion. Can you guess the scientific principle underlying the act?

Q.: What is worthless and light in weight is blown away by the wind. What is precious and heavy is not affected by the movement. Yes, it is clear now.

B.: நல்லத◌ ! [Tom: good]

Q.: One imagines things and enjoys them by virtue of his strength of imagination. It is said that gross manifestations of such mental creations are possible for Brahma the Creator. Should the same power not be available with His creation, man?

B.: That is your opinion.

B.: J.K. says that man should try to find out the ‘I’. Then ‘I’ dissolves away, being only a bundle of circumstances. There is nothing assertible behind the ‘I’. His teaching seems to be very much like the Buddha’s.

B.: Yes. The truth is well beyond possibility of conceptual expression or explanation. It is pure Experience only, for there is no experiencer. When you finally do reach the Self, you will be shocked to discover that you have been foolishly searching frantically for something that was always right in front of your nose – no, even closer, for the nose and the object in front of it must be seen with the eye to ascertain their apparent existence, whereas the Self requires no perception to support its actual existence. The Self is pratyakshasakshathswayamprakasha-swaroopam. Everything shines in and by its light, but it knows nothing but itself. It shines by its own light alone. The lusturous beauty of it never fades. It is truly immutable, indestructible and imperishable. One who loses himself in it has no more cares or worries. It is the one true goal of man’s life, yet it is here and now. That is the great mystery.

Ramana Maharshi: Q. How to surrender and how to live and survive if we have completely surrendered? Partial surrender vs total surrender | Aham Sphurana

~ Tom Das ~ Leave a comment

3rd August, 1936

Q.: After conversing with several devotees here, I have arrived at a rough observation that Sri Bhagavan gives spiritual advice which pertains to every conceivable genre, depending upon the inclination, maturity or palate of the aspirant in question. What, if any, is his nativistic teaching?

B.: [no response]

Q.: Is it Silence?

B.: Yes.

Q.: For those unfit to understand it?

B.: They are advised to keep quiet. [Summa iru.]

Q.: For those even this?

B.: The inquiry ‘Who-am-I?’ is suggested.

Q.: For those like me who lack the determination to practise this inquiry?

B.: Unconditional surrender.

Q.: To whom shall I surrender? To Sri Bhagawan or to my Guru Sri Chandrasekara Barathi of the Sringeri Mutt?

B.: Does surrender need a recepient? Simply surrender or let go of everything.

Q.: If I let go of everything, is Mukti assured unto me?

B.: To let go of everything is to let go of this question also.

Q.: So, expecting a reward for surrender is not appropriate?

B.: How can one who has surrendered expect anything? To surrender is to give up the spurious ‘you’ once and for all. When you are not there at all, where is the question of expecting or anticipating anything? Who would be there to do the expecting or anticipating? If there is still anyone left to engage in expecting or anticipating, no surrender has really taken place.

Q.: If I give up everything, what will happen to my body? How then will it be able to find food for itself, leave alone earn a living or maintain a family?

B.: Were you asked to neglect the body? You were asked to not deliberately take care of the body – that is all. How is it that you translate the directive, ‘Let go of everything.’ into ‘Neglect the body and its duties.’? The problem in its totality lies in the fact that you are labouring under the delusive impression that it is you as the ego who are maintaining your body, attending to your vocation, taking care of the household and everything else that it has fallen upon the body’s prarabdha to execute in this lifetime. So, when asked to give up everything, that is to say give up the ego, you give yourself to understand that your regular routine will come to a standstill.

No. Whether you are aware of it or not, whether you like the fact or not, the truth is that it is the Higher Power that does everything. We imagine ourselves to be the doer. When asked to give up the personal self, we imagine that the body’s actions also should come to cessation, because according to us, it is the personal self that is the cause and source of all action. No. It is a mistake. The ego merely fraudulently assumes responsibility for the actions of the body. Doerless doing or actorless action is not for the Jnani only; it is true – as an actual fact – in the case of all. In the case of the ajnani, something called “I” rises up to falsely claim responsibility for the body’s actions. This fictitious accreation is absent in the case of the Jnani. That is the only difference between them.

If you give up the ego or ‘Body-am-I.’ idea completely, some power effortlessly takes over the body and makes it run through its ordained course of prarabdha without the need for the least mental involvement or participation on your part. This is a matter for experience. To surrender is to totally let go of everything. People attached to concepts of the intellect or things of the world cannot possibly let go; vairagyam is necessary to let go. How to cultivate vairagyam? Proximity to the Guru.

Worldly attachment and the Guru pull the mind in opposite directions. If Love for the Guru is unequivocal and unconditional, His pull eventually wins. Again, how to cultivate this Love? By nature the minds of most men are occupied with the problems of the personal self. What vocation shall I pursue? Shall I study further or shall I opt for employment? Shall I marry the girl I like, or shall I marry the other one, the rich, obese character that I was introduced to by my parents? What measures shall I take to safeguard myself from penury in old age? How shall I ideally invest my wealth so that it stands me in good stead when I am no longer in a position to actively work to earn a living? Will my children take care of me in old age or will they abandon me and go their seperate ways? And so on and so forth.

This is how lifetime after lifetime is wasted. If you would only keep quiet without thinking these thoughts, providence would admirably take care of you; but no, you must have your ‘knowledgeable say’.

It so happens that in rare cases a man ceases to take thought of his personal self and wholeheartedly gives himself to an ideal of beauty, be it sport, literature, art, patriotism or anything else. The quantum of importance attributed to the personal self becomes negligible when the loftier pursuit occupies the whole of his attention. Thus he begins, for the first time, to experience a Love in which the personal self has no space. Such is the sweetness of this passionate Love that he yearns to experience the pinnacle thereof. The desire for this feeling of Love is not motivated by the objective of personally experiencing it. The Love for the higher ideal eventually comes to dominate and possess the soul with such complete fervour that his desire for such Love is not on account of any motive to personally experience it, but simply for the sake of such Love itself.

He does not think, I must experience more of this Love. He thinks, this Love must shine forth with the utmost possible intensity! Then, the ideal towards which Love hitherto had been directed merges imperceptibly into Love itself. Thus, the man is left with Love and only Love in his hands: Love without rhyme or reason.

Feeling it but unable to attain it, he becomes crazed with longing. It is at this stage that God or Guru appears to him as the manifestation of his Love: the manifestation may or may not be an anthropomorphic form; it may be an abstract image or ideal altogether deviod of form or even name. Eager to consummate his Love, he surrenders totally to the Guru and Realisation devours him by operation of the Guru’s benevolent grace.

Swami Vivekananda has said, ‘Take up one idea. Make that one idea your life – think of it, dream of it, live on that idea. Let the brain, muscles, nerves, every part of your body, be full of that idea, and just leave every other idea alone. This is the way to success.’.

So, volitionless Love, which, allowed to wax indefinitely, surely leads to Kaivalyam, may as well come to an inveterate materialist or atheist: belief or faith in God is not of any considerable importance, for it stops at the level of the intellect – it is Love that matters, uncaused, blind, mad, unconditional Love. In the work The Pilgrim’s Progress by John Bunyan, when Christian is about to drown in the dreaded river of Death, he has a vision of the Christ who reminds him of the verse: ‘When thou passest through the waters, I will be with thee; and through the rivers, they shall not overflow thee…’. The next moment the Christian finds steady ground to stand upon, and he manages to ford the remaining strech of the river safely.

Likewise, when Vasudeva was travelling to the house of Nandagopa and Yashodha, carrying the infant Krishna in his arms, the Yamuna river was in full spate, ready to devour him should he behave so unwisely as to step into it. Vasudeva thought of God and was immediately assisted by the giant 10-headed celestial serpent, Vasuki; thus he managed to ford the flooded river without incident.

Again, when Sri Abbanacharyal heard the news that his Guru, Swami Raghavendra, was about to enter into his brindavanam, he forthwith rushed to Mantralayam, but did not know what to do when he was faced with the flooded Tungabhadra. He gathered courage, closed his eyes, thought of his Guru, and threw himself into the raging deluge. He was not swept away by the river, but landed safely on the other bank.

How did all this become possible? Is not genuine Love for the Lord on the part of the devotee the reason? Thus, develop a deep obsessive infatuation with any particular ideal, and of itself that will plunge you into unfathomable Love; such Love invariably leads to Kaivalyam.

Q.: I am too weak to surrender, in the total sense of the term that I find Bhagawan suggesting. Also, I do not feel attracted to any one particular ideal or idea. What am I to do?

B.: It is holding on or doing anything that requires strength. If you feel you are weak, letting go of everything should be very easy, for that alone is non-doing.

Nevertheless, if total surrender is found too hard, practise surrender as a sadhana. This is called partial surrender. In course of time it leads to complete surrender.

Q.: Various descriptions of God are given by scriptures belonging to the different religions. Which is the description that tallies with Bhagavan’s teachings?

B.: Words cannot convey the Real. Yet, the closest is, Ehyeh asher ehyeh.[Tom: Hebrew, from Exodus 3:14 meaning ‘I am that I am’]

Q.: What is the difference between attempting on one’s own to Realise the Self and taking the help of a Guru?

B.: Suppose you want to go to America. Which is the sensible method? Taking a spade in hand and digging into the Earth, saying, ‘I am confident that I shall eventually reach America, which must be located on the exact other side of this very spot.’ or booking a place for yourself on the next outbound steamer?

The above excerpt is taken from Aham Sphurana, 3rd August 1936, see here for more information on this text.

Ajata Vada as explained by the Ribhu Gita

~ Tom Das ~ 2 Comments

This article is an excerpt from a much longer article which you can view here, that gives further quotes on this same topic from others including Sri Ramana Maharshi, Sri Shankara, Suresvara and Ribhu Gita. The original article also gives disclaimer which you should read (ie. these teachings are for earnest seekers only and can have detrimental effects for those not ready for them) and makes some suggestions as how to best appraoch these teachings.

Here are quotes from The Esssence of Ribhu Gita (download the full text here) that contain the Ajata Vada doctrine. Of course the Ribhu Gita itself contains many more quotes that these on Ataja Vada, with almost every chapter hammering home this most radically non-dual teaching:

5. The universe was neither born, nor maintained, nor dissolved; this is the plain truth. The basic screen of pure Being-Awareness-Stillness devoid of all the moving shadow pictures of name and form of the universe is the sole, eternal Existence. (Ch.2, v.33)

9. The universe of name and form, the embodied creatures and their creator, mind, desire, Karma (action), misery and everything other than the Self, are merely thought formations projected by the powers of the Self on its screen — Self. (Ch.5, v.25)

10. The state of firm abidance in that thought-free alert Awareness-Self, constitutes integral perfection, yoga, wisdom, Moksha, Sahaja Samadhi, the state of Siva and the state of Atman-Self, which scriptures proclaim by the title of Brahman. (Ch.5, v.26)

11. There never was a mind nor any of its countless forms like world, jivas, etc. There isn’t the least doubt that all these are the form of the eternally undifferentiable Supreme Brahman-Self. This is the Truth. The one who hears this great secret diligently and understands completely, abides as Brahman-Self (Ch.5, v.28)

14. …That Siva must be meditated upon and realised to be the Self, by making the restless mind stay still and alert after it has been adequately restrained, and completely prevented from the pursuit of sense objects, namely, the shadow pictures on the screen of the Self. All shadow pictures removed, what remains is pure Awareness, the spotlessly effulgent screen. Thus, Siva reveals Himself spontaneously as the sole eternal Sat-Chit-Ananda-Self, the very essence of the nature of the worshipper. (Ch.7, v.35)

24. The total discarding of the mind is alone victory, achievement, bliss, yoga, wisdom and liberation. The sacrifice of the mind is, in fact, the totality of all sacred sacrifices. (Ch.15, v.7)

35. Firmly established in the Self, undisturbed by the least ripple of thought, as still as an idol of stone or wood, dissolved completely in Brahman-Self, even as water is in milk, with awareness devoid of all impurities of thought and drowsiness, standing clear as the pure sky, the grandeur of the Jnani’s nishta (firm stance in the Self) defies thought and expression. (Ch.19, v.21)

40. Abidance in the state of thought-free alert Awareness, is the state of mukti beyond thought and expression. The emergence of thought is the bondage of untold suffering. Abidance in the Self is the true non-dual samadhi, and that alone leads one to the eternal bliss of mukti. (Ch.21, v.41)

43. There are no such things as achieved objectives and the efforts leading to them, association with the wise or the ignorant, efforts of learning and knowledge acquired, acts of enquiry and practice, the learner or the learned, and any goals achieved. What exists is only Brahman, the effulgent Awareness-Self. (Ch.23, v.10)

44. One should be firm in the conviction that there are no charitable acts, sacred waters and kshetras (pilgrim centres), no loss or gain and no loser or gainer, no karma, bhakti and wisdom, and no knower or known. All these thought-forms are bound to be dissolved and lost in the Brahman-Self, which is the sole existence. (Ch.23, v.11)

46. The illusion that one is the body and that the world is the basic reality has remained soaked over a long, long time, and cannot be got rid of by the casual reading and mere understanding of the truth. The basic illusion can be effaced only by a long and unremitting practice of the bhavana that all this is ‘I-am-Brahman-Self’. (Ch.24, v.28)

48. There is never such a thing as conception of names and forms, no such thing as the conceiving mind, no such thing as a person lost in samsara, and no such things as the world and its creator. Everything that is seen to exist must be realised to be no other than the sole, pure Awareness-Being-Brahman-Self. (Ch.25, v.8)

51. By abiding in the Self, the wandering mind is reduced to perfect stillness after being freed from all nescience and thought currents. It gets lost in the Sat-Chit-Ananda-Self in the same way that water is lost when mixed with milk. This unitary state of abidance in the Self is called Atma Nishta by the wise who have attained perfection. (Ch.26, v.2)

54. In that Self wherein there is neither conceiver nor conception of the world of names and forms, one should remain blissfully still, eschewing the least trace of thought. (Ch.26, v.8)

55. In that Self wherein desire, anger, covetousness, confusion, bigotry and envy are all absent; in that Self wherein there is no thought of bondage or release, one should abide blissfully still, eschewing the least ripple of thought. (Ch.26, v.13)

57. Mind merged completely in the Self, one becomes a lord without rival-steeped in bliss beyond compare. In that state one should abide still, free from the least trace of thought. (Ch.26, v.28)

58. I am that Self which is integral existence-awareness-bliss, the sole impartite Brahman-Self. Firm in the conviction born of this experience, one should abide still, free from the least trace of thought. (Ch.26, v.29)

59. In the conviction that ‘I am the Self’ in which no thought, ego, desire, mind or confusion can exist one should abide still, free from trace of thought. (Ch.26, v.31)

60. The firm faith of being the Self is sufficient to dispel all thought and establish one in Brahman-Self. In due course of this practice, even the thought involved in that faith fades away leading to the spontaneous effulgence of the Self. If a person hearkens to this teaching and practises the faith, even if he is a great sinner, he is washed clean of all his sins and is established in Brahman-Self. (Ch.26, v.42)

61. There is certainly no such thing as mind with its constituents of thought and thought forms of objects. In this conviction one should ever abide still and at peace, in the state of thought-free alert Awareness-Self which endures after all sadhanas and its rigours have exhausted themselves in Brahman-Self. (Ch.27, v.29)

62. Having gained the experience that there is no creator, no maya, no duality, and no objects at all, and that pure Awareness-Self alone exists, one should ever remain still and peaceful in that state of Selfhood. (Ch.27, v.34)

63. If a person gives heed to these teachings he would certainly gain the grace of Lord Siva and attain the state of Selfhood even though he is immersed in the dense darkness of nescience which could not be banished by the glare of a million suns. (Ch.27, v.43)

64. Why waste words? This is the truth in a nutshell. Only those who have earned the Grace of our Lord Siva by long devotional worship will get the rare opportunity of reading this scriptural text which leads to the bliss of peace everlasting in Brahman-Self. (Ch.27, v.44)

65. Only that Jnani who teaches ‘Thou art the thoughtfree, alertly aware, absolutely still, ever blissful, intensely peaceful, unqualified Brahman-Self’, is the true Sat Guru, and others are not. (Ch.28, v.28)

66. Unbroken abidance in the state of alert awareness, unruffled by thoughts, is Self-realization. That is at once the spotless jivan mukti and the magnificent videha mukti. This state is easily attainable only for those who have earned the divine Grace of Siva by deep devotion to Him, and not for others. What is stated here is the import in a nutshell of the message of that charming crest jewel of the Vedas known as the Upanishads. (Ch.29, v.37)

67. Those who give heed to this message and abide in accordance with it will forthwith attain mukti (liberation). They will not suffer from the least particle of affliction; they will enjoy a bliss far greater than the bliss attained from this and all other worlds; they and their environments will be filled with the plenitude of auspicious events. Totally free from all trace of fear, they will never again enter the cycle of births and deaths. They will become the immutable Brahman-Self. All this we swear is the truth beyond doubt. By our Lord Siva, again and again we swear that this is the fundamental truth. (Ch.29, v.40)

69. By the persistent and continued bhavana of ‘I am the Brahman-Self’ all thoughts and feelings of differentiation of Self and non-Self will drop off and permanent abidance in Brahman-Self will be achieved. This bhavana is possible only for those with a keen inquiring mind intent on knowing the Self and not for those who are indifferent about Self-knowledge. (Ch.32, v.18)

70. Ignorance and indifference in regard to the enquiry of the truth about one-self is the store house of nescience and trouble, blocking the view of the Self, and creating in a split second all sorts of illusions and harassment of mental worry. Non-enquiry renders bhavana impossible. (Ch.32, v.19)

71. In short, non-enquiry will steep one for ever in the ocean of samsara (earthly suffering). There is no greater enemy for one than non-enquiry. Therefore, this habit must be overcome in order to fix the mind in the bhavana which leads to abidance in the Self. (Ch.32, v.20)

73. Staying in the company of sadhus (those engaged in the pursuit and enjoyment of the bliss of the Sat-Self) and respectfully questioning the Sat-Guru-Jnani, one should first make oneself clear about the objective to be obtained. This is an important aspect of the enquiry. After thus making sure of the objective, one must firmly abide in that objective of sole Brahman-Self until the Self is unmistakably experienced. (Ch.32, v.22)

74. The conscious introspective concentration of Self enquiry (‘Who am I’?) kills all thoughts and destroys the dense darkness of nescience; it effaces all worry; it illuminates the intellect with the radiance of pure awareness; it wipes out all conceptual confusions; it fixes one in Siva-Self; it transforms a host of impending disasters into auspicious events; and lastly, it destroys the ego-mind utterly with all its afflictions. (Ch.32, v.24)

75. Only by those strong willed persons who make earnest and persistent Self-enquiry will the turbulent mind be controlled and fixed still in the practice of firm bhavana. In due course all thoughts and nescience will disappear, yielding place to the effulgent Awareness-Self of mukti. (Ch.32, v.26)

76. One should relentlessly pursue Self-enquiry until all conceptual forms of creature, world and creator merge and disappear in the pure thought-free, alert Awareness-Self, enabling one to abide in that bhavana of the experience, ‘I am the Brahman-Self’. (Ch.32, v.27)

103. I am verily the Sat-Chit-Ananda-Brahman-Self. I am the eternal undisturbed peace devoid of name and form. I am the flawless integral whole of all existence. Firmly I am settled in my sole Brahman-Self. (Ch.40, v.10)