Q. I want to become a Jnani, what should I do? Sri Ramama Maharshi | Aham Sphurana

The following excerpt is from the text Aham Sphurana 18th August 1936 – you can download the entire text here

Questioner: I also want to Realise the Self and become a Jnani like Sri Bhagavan. What should I do?

Bhagavan Sri Ramana Maharshi: Do not do anything. Step aside and permit the Light to Shine.

Q.: I do not understand what I should do to Realise the Self.

B.: Summa Iru. It means, ‘Remain naturally without thinking.’

Q.: As distinct from suppression or control of thought?

B.: Yes.

Q.: In my case effort is needed to remain without thinking.

B.: That is the problem.

Q.: How am I to reach the state wherein I am able to effortlessly remain in the state of absence of thoughts?

B.: Only by pursuing the investigation ‘Who-am-I?’.

Q.: How long to investigate?

B.: Until investigation is no-longer possible.

Q.: If I am able to effortlessly remain in the state wherein there are no thoughts, can I also become a Jnani?

B.: Undoubtedly.

Q.: God’s Grace is said to be necessary for it.

B.: Yes.

Q.: How to win God’s Grace?

B.: Only by relentlessly pursuing the investigation.

Q.: Is not everything predetermined?

B.: That argument is not meant to be used to justify anticipation of failure.

Q.: So long as the idea or belief ‘The world is real’ is sustained within the mind, vichara will yield no benefit. Am I correct?

B.: Yes. But the vichara itself will progressively facilitate you to see the truth.

Q.: Is it belief in the objective reality of the world that is preventing me from Realising?

B.: Not only that idea, all arbitrary-mental-conceptualisations [vrittis] must be eradicated from the mind before there can be any possibility of Realisation.

Q.: Why so?

B.: Vrittis [mental modifications or arbitrary-mental-conceptualisations] act as water in a cauldron which reflects the Sun as an image upon its surface. Thoroughly empty the cauldron. That is the nivritti state of mind. When the cauldron has been toppled and broken into pieces, chance of reflection – any further – is permanently ruined. This is the Sahaja-stithi of the Jnani. [Tom: Sri Ramana is stating that all vrittis (mental modifications or thoughts) must cease for realisation. When the mind is destroyed (through self-enquiry) and can no longer generate thoughts, that is the Sahaja or natural state of self-realisation, also known as self-knowledge]

Bhagavan then turned to the attendant and asked him to pick out a certain volume of the Bengali work Sri Ramakrishna Kathamritha. But that gentleman could not succeed in identifying the same from the book-case. Bhagavan himself retrieved the same and presently read out for the Hall in Tamil:

‘One attains the state of Brahmajnana when the mind has been destroyed. When the mind disappears and the ego has scarpered without leaving behind the least residue, that which was repeating I,I is discovered to have always been non-existent. It is possible to reach this state through bhakti or jnana. The Jnana-anveshaka considers the world as a mere dream or hallucination. Once perception of the world has ceased, only the ‘I-Consciousness’ remains. Imagine that there are 10 cauldrons filled with water. They all reflect the Sun. Now, totally how many suns do you see?

A Devotee – Ten reflected suns and the one true Sun.

Sri Ramakrishna – Imagine now that one of these cauldrons shatters into pieces. Now how many suns do you see?

The Devotee – Nine reflected suns and the one true Sun.

Sri Ramakrishna – Well, supposing that nine cauldrons are broken, how many suns would you see?

The Devotee- One reflected image of the sun and the one true Sun.

Sri Ramakrishna – What remains after the last cauldron is broken?

The Devotee – The one true Sun.

Sri Ramakrishna – No. No words can possibly describe what remains. It is what really IS. When there is no reflected sun, how can you tell that there is the real sun? In the state of samadhi the ‘I’ vanishes. What a man experiences then cannot be expressed through ideas when he comes down to a lower plane.

Q.: Is Bhagawan now talking to us from a lower plane, then?

B.: Sri Ramakrishna is describing nirvikalpa samadhi. In the Sahaja-stithi there is no lower plane or higher plane. [Tom: some say there are 2 aspects of reality – that which is with form and changed, and the unchanging formless, and that these 2 are actually a single inseperable whole. However, this is not the actual truth – it is an idea of truth that the ego may like and understand, but not the truth itself. Bhagavan is telling us that the Self, devoid of name, movement and form, that alone is the reality, and that is beyond words and ideas and concepts, that cannot be understood or conceived]

Q.: The example befuddles me. The Sun is never obscured by its reflection on any number of surfaces. Reflections of the Sun do not affect the Sun itself in any way.

B.: Exactly.

Q.: But the Self is obscured by the ego.

B.: Did the Self complain of being obscured by the ego?

Q.: So bondage is a fact only from the ego’s point of view.

B.: Quite so.

Q.: In that case how did the ego arise?

B.: Whose ego?

Q.: Mine. But who am I?

B.: Find out.

Ramana Maharshi: Jnanis and Avatars – Aurobindo, Meher Baba, Krishna, Jesus, Buddha | Ask and ye shall receive Aham Sphurana

The following is taken from the text Aham Sphurana, 7th July 1936. Please see here to find out more about this text:

Questioner: Yes, some say Aurobindo is the Avatar of the age, while others say it is Meher Baba; still others say it was the late Sai Baba. Yet others maintain that Sri Krishna was the last Avatar in the Anthropomorphic form, before Kalki Avatar arrives at the time of Cosmic Dissolution. For others it is Buddha, Ramakrishna or Confucius. Will Bhagavan tell us in what way His experience of consciousness is superior to that of these, since, allegedly, they seem to be mere Avatars, and not Jnanis? And really who is the Avatar corresponding to this Era in Mankind’s history, a particularly tumultous one – Germany has announced her intention to rearm herself, an indication of the belligerent attitude of the National Socialist Government? Surely an Avatar is necessary from age to age to look after the world to ensure that mankind’s evil-doing collectively remains lesser than his acts of benignness? Jnanis do not act in the world, except to ensure the merest existence of the physical body, is that not so? So, where is the Avatar who is going to look after our poor mortal selves- and also the world?

Bhagavan Sri Ramana Maharshi: Experience of Consciousness, if genuine, naturally precludes ‘others’; thus there is nothing superior or inferior, because there is no second, no other, nothing foreign or alien to or apart from the One Immutable Absolute Self – so the question of comparison is, simply, nullity.

All True Masters are ONE, not because they identify themselves with something in common, but because commonly the faculty of identification [of one thing with another] does not exist in any of them. As for Avatars, each one sees an Avatarapurusha [Tom: purusha means person] according to his own mental convictions and predispositions – to establish the finality of one’s own viewpoint admist others will result only in fruitless skirmishes. You may continue to believe in whatever pleases your own fancy, but expecting corroboration from others for your weltanschauung [Tom: world view] of the universe will serve only to increase your sense of mental unrest and agitate the mind further.

Q.: So the idea of the Avatarapurusha, God-manifest/God-incarnate, who comes down from age to age, is just… a fallacy, only as good as a fairy-tale? Do not the Holy books of the various faiths speak of these blessed beings, whom we might worship – since manifestation makes available a form to worship – so that we might elevate ourselves to the zenith of spiritual perfection and purity, puissance and divinity? Jesus, Mahomet, Zoraster, Buddha – what about them? Specifically does not Krishna say, parithranaya sadhunam… etc.? How can these considerations be ignored?

B.: Your mental predilections and proclivities foist upon you the erronous idea that there is a God outside your Self, and that He sends down messengers to guide you and show you the way to reach Him. If you keep on journeying, you will never reach. Therefore, I say, enough searching – call off the search and be yourself, nothing more. The great masters – each in his own tongue, but each from the same Heart – yearned to give you this message only – BE YOUR SELF.

The Masters you mentioned, and others, each doubtless had – and has and continues to have always – his specific, special or unique role in man’s spiritual evolution, but the zenith spoken of by you will certainly not be reached by discussing the question, ‘How can all of these Mahanubhavars be right? On what points do they contradict themselves? Is it not our imminent task-on-hand to clear up these apparent contradictions and seeming mutual inconsistencies? Will that not endow us with special spiritual merit?’ Men waste entire lifetimes – fruitlessly – like this. This effort, if harnessed fully to keeping one’s Latchiyam [Tom: aim or target or goal] fixed entirely on Self or Reality, would have resulted in Mukthi long ago. Instead, countless lives have been frittered away on account of these wrong and foolish ideas about reaching Truth by using the Buddhi or the resoning faculty, when, in fact, precisely subsidence of that faculty results in revelation of Self or Reality. What a pity.

Q.: It is still not clear. The Avatara Purusha – is he just a mental concept like the gandharvas, rakshasas, bhutas, etc.? Has not this tangible world witnessed the advent of many such great men, Bhagavan himself not excluded?

B.: The trouble arises when we use their teachings to satisfy our intellectual palate and appetite. To the unwise, it does not occur to try and practise, instead of using it as a subject of discussion at gatherings of philosophers and metaphycists.

Therefore I say – Do not try to write essays on it. Do not try to present articles of great erudition on it. Do not try to gain followers for your newly discovered maxim or device-of-apotheosis or precept-of-ancient wisdom. Do not conceptualise it mentally and then, getting trapped in those very concepts, moan and complain that you ‘see no progress’. Do not go on discussing or talking about it. Do not tell yourself, ‘First I shall obtain intellectual mastery over the technique and subsequently shall begin the application thereof.’

Instead – plunge into the practice HERE and NOW; stick to the teachings of any one Mahanubhavar, and all will come right in the end.

Masters are there only to show you the way – man fogs the fulfilment of their purpose by merely theorising or intellectualising about their respective lives, advents and teachings, such as asking – Is this one or that one a Siddhapurusha, Muktha-purusha or an Avatara-purusha? Of course these are your mental concepts only. In fact, the Master, being not at all different from the formless Absolute seated in the tabernacle of the Sacred Heart of Man, is really synonymous with your own True Self – why seek him anywhere else?

Q.: For myself I am now convinced, but I am worried about the hopeless spiritual condition of the world, which seems to be enveloped in profuse darkness. When will all the people of the world wake up to the fact that they are living in the ghastly darkness of ignorance, and understand that the world around them is a dream, so that they can obtain genuine illumination? What about those unfortunate ignorant millions of the world, who have never met a genuine Sadhguru in their life? Supposing their prarabdha-karma dictates that they spend the entireity of their lives being relentlessly tossed around in the evil sea of avidya maya, as a result of the Guru’s accquaintance never coming to transpire- what then? For how many lifetimes more will their ordeal of ignorance have to last, and when at last would such unfortunate ones meet their Guru- so that through Him their redemption could be vouchsafed for certain? Such unfortunate persons, never having had the extreme good fortune of meeting B. during his blessed sojourn on this Earth, which, owing to his stay here has become itself a sanctified land, must needs count themselves exceedingly unlucky- what, therefore, would Bhagavan have them do? What can they do? What will be their fate?

B.: The fate of each one depends upon his merit. Take care of yourself and others can take care of themselves.

This answer was evidently not to the questioner’s liking. He seemed to toy with the idea of placing forth additional arguments before Bhagavan as to why mercy ought not to be showered in profusion upon the ‘ignorant’ masses of the world, until Chadwick pacified him with the following words:-

“Bhagawan has said that when longing for God or intensity of meditation has reached a feverish intensity/pitch, the Guru automatically manifests before the devotee.”

Even then, the man seemed about to say something, when the Hall’s attention was riveted by Bhagavan’s voice suddenly reading from Scripture the words of a Jewish Carpenter no less a genius in the realm of Spirit, the heartthrob of many a lonley, man-forsaken soul yearning for Divine acceptance –

“Ask, ye shall receive; Seek, ye shall find; Knock, it shall be opened unto thee.”

Q. Why are some of our prayers not answered? How to know if a Jnani is genuine? | Sri Ramana Maharshi | Aham Sphurana

The excerpt below is taken from the text Aham Sphurana (see here to find out more about this text and download a copy for free), 20th July 1936:

Questioner: It happens to some that they pray – in all good faith – to God, yet their prayers are unequivocally repudiated. What is the reason?

Bhagavan Sri Ramana Maharshi: Can you be trusted to know what is best for you?

Q.: I should hope so.

B.: That is your opinion.

Q.: What then is Sri Bhagawan’s opinion?

B.: ‘O Lord, thou hast searched me, and known me. Thou knowest my downsitting and mine uprising, thou understandest my thought afar off. Thou compassest my path and my lying down, and art acquainted with all my ways.’

Q.: The implication being?

B.: He knows what is best for you; you do not. Therefore unconditionally surrender yourself to him and leave your fate in his hands. That is the only thing to be done. Prayer is merely a lower form of surrender. It is highly prone to failure, because if what is asked does not aid Realisation, it may not be granted, even though you may be thinking that what you are asking is going to [serve as an] aid in Realisation. Or, your karma may not permit the request to be granted.

Q.: Spiritually-inclined people pray for strength to inrovert the mind. Or, they pray for Self-Realisation. How can that be not an aid in Realisation?

B.: Because it posits the dangerous notion that there exists an [individual] “I” who craves for himself the state called Realisation. Such prayers are unnecessary. Maam Aekam Sharanam Vraja. ‘Only surrender to Me.’

Q.: Why does God allow karma to meddle with even the efforts of sincere aspirants who are trying to Realise?

B.: The arrangement of karma – [for karma itself is] unavoidable – is actually adroitly done in such a way as to give the sadhaka the maximum possible chance of completely cleansing the mind of all vritts. So, if you are destined to Realise in this lifetime, rest assured that your karma has been ingeniously arranged in such a manner as to inevitably take you to the Goal.

Q.: And if I am destined otherwise?

B.: Perhaps you would not be here today.

Q.: The same astute God who manipulates karma so carefully – why was he not careful enough to safeguard the Self from slipping into the bondage of ignorance?

B.: Does the Self complain of having thus fallen?

Q.: No. But I do.

B.: Are you apart from the Self?

Q.: The mahavakyas state that I am supposed to be one with Brahman.

B.: And your Experience is in Corroboration?

Q.: Alas! No. All I feel is the miserable ego.

B.: Yes. Misery is one with the ego. Kill the ego.

Q.: It seems to be an impossible accomplishment even for those with decades of systematic training in the spiritual field.

B.: There is no accomplishment possible. What is intimate and inherent cannot be accquired. The only thing to do is destroy the useless accreations that cause all the nuisance. We are not trying to attain anything. On the other hand, we are trying to give up everything.

Q.: Should I not try to attain Realisation of the Self?

B.: No. Give up everything. Only the Self remains.

Q.: It sounds simple enough. Yet, only one in a million men manage to reach this supreme state, according to Sri Krishna. Does it mean that, at any given point of time in the world, the number of Jnanis living should be a precise 0.0001% of the total population?

B.: [laughing] Possibly!

Q.: In my view even this seems an outlandish estimate. Are there now circa 269 Jnanis living in India, then, regard having been had to the numbers available by the 1931 Census?

B.: [somewhat mordaciously but without deviating from his good cheer] Why not? Do you suppose all Jnanis are unfortunate enough to be put in a cage like this, and put up for ‘public examination’? [in English:] Ladies and gentlemen, presenting… THE FREAK SHOW! Exhibit No. 1 – Sharji, the Venus of the Hottentots! Exhibit No. 2 – Elephant-man Merrick! Exhibit No. 3 – The ‘Bhagawan’, Ramana! அ என்ன பாழாகப் ேபான பகவானே◌ா [Tom: What a waste, O Lord] . No. Only those whose prarabdha is destined to be exceedingly miserable suffer like this! Sri Gandhiji has written, ‘The woes of Mahatmas are known to Mahatmas alone.’ [laughs heartily]

Q.: Other Jnanis, who, according to Bhagavan, enjoy a better prarabdha – they would be meditating in solitary places such as inaccesible jungles and caves, well away from habitable zones of humanity, I presume…

B.: You may presume whatever you like, no doubt…

Q.: So I am wrong?

B.: It all varies according to prarabdha. The Jnani is unfazed by what happens to the body. He has nothing to do with it. He has no localised consciousness functioning from within it. Killing it cannot harm him. Torturing it cannot affect him. He is absorbed by the Beyond, and quite lost there – for good. He may have 4 wives and 32 children. He may be running a busy household with dozens of mouths to feed. He may be employed on both day and night shifts of duty. Or, again, he may be sitting in an inaccesible cave with sensory organs in an inactive state, body rotting. It may be either way, but all this can be only from the point of view of the onlooker, since action is altogether alien to the Jnani; he himself knows nothing, sees nothing, does nothing. He has quite perished. Only a Jnani can tell who is a Jnani.

A person might look like a simpleton, yet he might know himself as the immortal Self. Another may display an unending spout of vedantic learning, yet his mind may not in the least have subsided. In this topsy-turvy world, which must needs always judge by its usual yardstick of ‘doing’, it is the latter who is generally extolled as the genuine case. The result? Misery for all involved. People cheat themselves into believing that they are in the vicinity of a great Mahatma. The pretender eventually himself foolishly comes to believe that he must indeed be a great Jnani, since so many people praise him day and night. So his ego becomes bloated; as a consequence he lands himself in all sorts of unpleasant situations. So, display of vedantic learning may cause a great very many problems for all involved. It is best to keep quiet.

Q.: Bhagavan said a Jnani may have numerous wives. Polygamy is a sin as per Hindu dharma. Can a Jnani sin, then? As far as my knowledge goes, the Manusmriti allows taking the next wife only if the existing wife or wives are mentally ill, infecundous, or unable to participate in rituals for the departed ancestors.

B.: What the Jnani does is always right. This does not mean that a man is morally excused in pretending to be a Jnani and then conveniently committing all sorts of crimes.

Q.: But how to tell who is a genuine Jnani?

B.: Only by yourself becoming lost in Jnana. However, there is one exceedingly rare exception. If a particular Jnani is destined to be your Jnanaguru, when you meet him there is an inexplicable mutual outpouring of ecstatic Love. The Love mentioned here is not consummated by any physical act. It is consummated only by surrendering to the object of such Love. The Jnani himself never loves or hates; only, when he meets one who is destined to be placed in his ultimate care, he directs his attention toward that person. It is not volitionary, but rather Automatic Divine Activity. There is nothing in him left to choose. Unto one who has the pakkuvam [Tom: ripeness], the Grace or Love begins to flow of its own accord. The Jnana-guru might not look at the mature devotee or exchange words with him, yet, one who is Ready feels the irresistible onslaught of inevitable rapid mental introversion in the form of blissful divine Love. This way you can tell that the person in whose presence you have such experience, is your Jnana-guru. Again, this might not happen in the case of all aspirants.

Q.: I have so far not had any such novel experiences with Bhagavan. Can I still Realise in this lifetime?

B.: All will turn out Right in the end.

Q.: Sometimes Bhagavan does not look at visitors. He does not respond to their queries. Does he refuse them his impartial Grace?

B.: Have you seen how they seperate chaff from the Grain here? They pour the seeds on the றம◌் , and then trenchantly shake it in a speedious upand-down motion. Can you guess the scientific principle underlying the act?

Q.: What is worthless and light in weight is blown away by the wind. What is precious and heavy is not affected by the movement. Yes, it is clear now.

B.: நல்லத◌ ! [Tom: good]

Q.: One imagines things and enjoys them by virtue of his strength of imagination. It is said that gross manifestations of such mental creations are possible for Brahma the Creator. Should the same power not be available with His creation, man?

B.: That is your opinion.

B.: J.K. says that man should try to find out the ‘I’. Then ‘I’ dissolves away, being only a bundle of circumstances. There is nothing assertible behind the ‘I’. His teaching seems to be very much like the Buddha’s.

B.: Yes. The truth is well beyond possibility of conceptual expression or explanation. It is pure Experience only, for there is no experiencer. When you finally do reach the Self, you will be shocked to discover that you have been foolishly searching frantically for something that was always right in front of your nose – no, even closer, for the nose and the object in front of it must be seen with the eye to ascertain their apparent existence, whereas the Self requires no perception to support its actual existence. The Self is pratyakshasakshathswayamprakasha-swaroopam. Everything shines in and by its light, but it knows nothing but itself. It shines by its own light alone. The lusturous beauty of it never fades. It is truly immutable, indestructible and imperishable. One who loses himself in it has no more cares or worries. It is the one true goal of man’s life, yet it is here and now. That is the great mystery.

Shankara – there is no Prarabdha Karma for the Jnani (and Sri Ramana Maharshi says the same) Advaita Vedanta | Swami Chinmayananda | Nisargadatta Maharaj

Also see:

Does the liberated Jnani or Sage see the body, the mind, the world or the 3 states of deep sleep, waking and dream according to Sri Ramana Maharshi and Sri Adi Shankara?

Ramana Maharshi – the 3 levels of the teaching

“The scriptures talk about prarabdha karma only for the purpose of easy understanding of the ignorant“.
~Sri Shankara, Aparokshanubhuti verse 97

“The statement that the jnani retains prarabdha while free from sanchita and agami is only a formal answer to the questions of the ignorant. Of several wives none escapes widowhood when the husband dies; even so, when the doer goes, all three karmas vanish.“
~ Supplement to the 40 verses on reality, written by Sri Ramana Maharshi

462-3:… it is to convince those fools who entertain a doubt like this, that the Shrutis, from a relative standpoint, hypothesise Prarabdha karma [as existing for the Jnani]
~Sri Shankara, Vivekachudamani

Traditionally it is said that when one attains liberation, all of that person’s karma is wiped out and so they will not be born again into a future rebirth, thus ending the cycle of samsara (the cycle of birth, experience, suffering, death and rebirth). Here the word karma, which literally means action or doing, refers to the momentum of cause and effect that causes things to happen in our life and in the future, including in future lives (for those who believe in reincarnation).

The question naturally arises, if there is no karma for the jnani (knower of truth or self, ie. one who has realised the Self and thereby attained liberation), how does their body continue to function? And surely there is some karma for the Jnani, for we see some Jnanis experience both good and bad fortunes. Why is this?

For a lower grade of seeker, the explanation is given that while all karmas* are destroyed for the jnani, prarabdha karma* remains. This prarabdha karma is the portion of karma needed to live out the current body’s life, and accounts for the good and bad things that the jnani experiences after self-realisation.

(*In Vedic traditions there are three karmas for the body: Sanchita karma (the total storehouse of past actions; sanchita means ‘heaped together’ or ‘collected together’), Prarabdha karma (the specific portion of Sanchita karma currently being experienced by this body in this life; prarabdha means ‘that which has begun’ or ‘that which has already commenced’, more commonly translated as ‘destiny’), and Agami karma (new actions being currently created now that shape your future; agami means ‘that which is coming’ or ‘that which is approaching’ or ‘future’)

The lower grade seeker is naturally satisfied with this answer and (perhaps because they are a lower grade seeker, or perhaps because they have faith in the teacher or teaching), they ask no further questions. They do not ask, how does this come about? How does some principle know to end sanchita and agami karma but continue prarabdha karma? And what is the mechanism by which this occurs? What principle governs this occurrence? Why does this prarabdha continue at all? Isn’t this dualistic, that some karmas are destroyed whilst others are not? And so on. The lower grade seeker simply accepts the teachings, as it gives their mind an explanation which makes sense to them, and the simple mind is often satisfied by mere explanations.

However, to earnest seekers who truly thirst for liberation, the great sages such as Sri Ramana Maharshi and Sri Shankara have said that this is just an explanation for the ignorant who consider the Jnani to be a body-mind entity, and that in truth, there is also no Prarabdha for the Jnani, for the Jnani has no body and sees no body.

We will look at some quotes from both Sri Ramana Maharshi and Sri Shankara that explain this, and also some commentary from Swami Chinmayananda that states the same, as well as teachings from Sri Nisargadatta Maharaj on this topic too.

We will see that the teaching there is no prarabdha karma for the Jnani and that there is no world for the jnani is in fact the traditional teaching of Advaita Vedanta that has been taught for centuries as per Shankara’s writings, and as per the writings of various others down the ages, and that it is only relatively recently, perhaps in the last 40-50 years or so, that a newer intellectualised form of Vedanta (that claims to be Traditional Advaita) has become more popular – Neo-Advaita it could be called.

First let us look at the answer to a question I was given here, which summarises the higher teaching, making it clear without additional complexity: https://tomdas.com/2022/01/15/does-prarabdha-karma-persist-after-realisation-liberation/

Questioner: I have a question, if Ajnanam (ignorance) is removed* that means the whole source of Samsara is removed. In such a case why should the Jnani (realised sage) even have Prarabdha Karma*. That also should not be present right?

Tom: In Truth, there is not even any such thing as a Jnani (meaning a person or body-mind that is ‘realised’) – there is only That Objectless Subject-Self-Brahman. So there is no karma whatsoever for ‘a Jnani’ (a Jnani here meaning the Self). The self has no duality, and no karma. Karma is born of ignorance and is maya, unreal. They are one and the same – karma and ignorance – or one comes from the other. This is also what is taught in the Upanishads (eg. Adhyatma Upanishad) and by Shankara, both in his commentaries and in texts such as Vivekachudamani.

*Removal of ignorance is the same as Self-Realisation, so say the Upanishads, so says Shankara.

**Prarabdha Karma is the portion of karma that, according to the Vedas, gives rise to the body in the present birth and will play out and determine the specifics of the present life. A simple translation could be ‘destiny’ or ‘what is destined for this life’. The idea of this question is that, for example, if you have ‘been bad’ in the past and have accumulated negative karma as a result, even though you have realised the Self, this negative karma may continue and cause suffering for you even after Self-Realisation. The Upanishads are clear that all karmas and all suffering end upon Self-Realisation, so one need not even fear the negative results of one’s past actions if one realises the Self.

We can see that even the notion of a body-mind entity, such as a ‘great sage’, is itself a fiction, for there is only the bodiless self, in which no body, mind or world ever appeared or ever could appear. All appearances are only due to ignorance, also known as ego or mind. In self-realisation, ignorance was seen to never have actually ever occurred, and the subsequent projection of the body mind and world was similarly never seen to have occurred. This is the doctrine of ajata vada, or the doctrine of no-creation, meaning nothing ever happened, or appeared to happen.

For the mind, this teaching makes no sense, for there is no worldly analogy that can explain non-duality or the Self, but this is what the higher teachings in the scriptures try to convey.

Sri Ramana Maharshi

Sri Ramana himself writes, in the supplement to 40 verses on reality the following:

The statement that the jnani retains prarabdha while free from sanchita and agami is only a formal answer to the questions of the ignorant. Of several wives none escapes widowhood when the husband dies; even so, when the doer goes, all three karmas vanish.

~ Supplement to the 40 verses on reality, written by Sri Ramana Maharshi

We can clearly see that Sri Ramana is stating that all three karmas go for the jnani, and that the idea that prarabdha continues is a ‘formal answer to questions of the ignorant’,  meaning it is a lower teaching for the masses who are either not genuinely seeking liberation, or in whom an intense conscious desire for liberation has not yet arisen.

But doesn’t the jnani see the world, but see it as illusion?

However some argue that the jnani still perceives the body, mind and world, but the prarabdha karma does not affect them, and this is what is meant by ‘there is no prarabdha for the sage’. Or they say that the body mind and world, together with its prarabdha, continue, but the Jnani sees them as being illusory. Sri Ramana writes the following to discount this view. Later we will also see that Sri Shankara makes the same point:

The Self-Realised Sage knows not whether the transient body comes and stays, or dies and leaves, even as a senseless drunkard knows not what happens to his clothes.

~ Guru Vachaka Kovai, Sri Bhagavan 24 (a verse written by Sri Ramana Maharshi)

We can see here that Sri Ramana is refuting the idea that the jnani even knows what is happening to the body.

Are we not just confusing levels here?

Some further argue that whilst on the absolute level (paramarthika or the level of the highest truth) the body mind and world do not exist, but relatively speaking (vyavaharika, or on the transactional relative level) they, together with prarabdha karma, continue.

This would mean there are 2 levels of the self and that the Self is non-dualistic. Sri Ramana clears up all of these in his teachings however, stating that for the jnani, there is only the one level – the truth ie. paramarthika  – vyvaharika only being apparently existent for the ajnani.

The following verses are from Sri Ramana’s teachings in the text Guru Vachaka Kovai:

21. There is no mind, nor body, nor world, nor any one called a soul; the One pure Reality alone exists, without a second, unborn and unchanging, abiding in utter Peace.

313. As one that is profoundly alseep in a carriage in unaware of the varying states of the carriage – (its running, stoppages and unyoking of horses [Tom: – ie. the 3 states of waking, dream and deep sleep]) – so the one in the Transcendental State is unaware of the varying states of the body.

We see the same teachings of Sri Ramana recorded in the text Paravidyopanishad:

39. Unless and until the mind becomes utterly extinct, these three states will continue to prevail. When the mind becomes extinguished the supreme state is won, wherein this world once and for all ceases to appear.

The state of liberation is often called ‘sahaja samadhi’. Sahaja means natural or easy, so this refers to the effortless state of self-realisation. In Talks with Sri Ramana Maharshi, talk 82, Sri Ramana is recorded as saying the following:

Just as a passenger when asleep in a carriage is unaware of the motion, the halting or the unharnessing of the horses, so also a Jnani in sahaja samadhi is unaware of the happenings, waking, dream and deep sleep.

…In sahaja samadhi the activities, vital and mental, and the three states are destroyed, never to reappear. However, others notice the Jnani active e.g., eating, talking, moving etc. He is not himself aware of these activities, whereas others are aware of his activities. They pertain to his body and not to his Real Self, swarupa. For himself, he is like the sleeping passenger – or like a child interrupted from sound sleep and fed, being unaware of it

Sri Ramana himself also writes in ‘Who Am I?’:

Just as the knowledge of the rope, which is the base, will not be obtained unless the knowledge of the snake, the superimposition, goes, so the realization of Self, which is the base, will not be obtained unless the perception of the world which is a superimposition, ceases.

And also from Sri Ramana’s ‘Who Am I?’:

Therefore, when the world appears, Self will not appear; and when Self appears, the world will not appear

There are dozens more quotes like this from the writings and teachings of Sri Ramana Maharshi, and I have collected some more together here: https://tomdas.com/2023/01/07/does-the-sage-jnani-see-the-world-does-the-world-exist-after-liberation-lakshmana-sarma-explains-verse-18-of-ramana-maharshis-ulladu-narpadu/

What about ‘Sahaja Samadhi’?

But doesn’t Sri Ramana Maharshi say that the jnani is in the state of Sahaja Samadhi, the natural state of liberation in which the sage is naturally and effortlessly unattached to the phenomenal world of objects (‘sahaja’ means ‘natural’ or ‘easy’)? Yes, he does, but this too is a lower teaching. See what he says in his higher teachings:

‘So also a Jnani in sahaja samadhi is unaware of the happenings, waking, dream and deep sleep…In sahaja samadhi the activities, vital and mental, and the three states are destroyed, never to reappear.

However, others notice the Jnani active e.g., eating, talking, moving etc. He is not himself aware of these activities, whereas others are aware of his activities. They pertain to his body and not to his Real Self, swarupa. For himself, he is like the sleeping passenger – or like a child interrupted from sound sleep and fed, being unaware of it. The child says the next day that he did not take milk at all and that he went to sleep without it. Even when reminded he cannot be convinced. So also in sahaja samadhi.’

~ Talks with Sri Ramana Maharshi, Talk 82

Nirvikalpa Samadhi

What is called Sahaja Samadhi, the natural state of the jnani, is also called Sahaja Nirvikalpa Samadhi or just Nirvikalpa Samadhi. These are synonyms for self-knowledge or self-realisation or liberation. Sri Ramana Maharshi wrote in his translation of the classical advaita text Drig Drishya Viveka:

‘being completely absorbed in the Bliss experienced by the realization of the Self is nirvikalpa samadhi‘

Sri Ramana Maharshi wrote a summary of Shankara’s teachings in an essay he wrote which you can find here, in which he wrote the following:

…the natural and changeless state of Nirvikalpa samadhi is produced by unswerving vigilant concentration on the Self, ceaseless like the unbroken flow of oil. This readily and spontaneously yields that direct, immediate, unobstructed, and Universal perception of Brahman, which is at once knowledge and experience and which transcends time and space. This perception is Self-realisation. Achieving It cuts the knot of the Heart. The false delusions of ignorance, the vicious and age-long tendencies of the mind which constitute this knot are destroyed. All doubts are dispelled and the bondage of karma is severed.

But don’t we see the Jnani/Sage eating, drinking, talking, walking, etc…?

Yes, the ignorant will see the sage as a body-mind entity (whereas the Sage is really just the objectless worldless Self, Pure consciousness), and this ‘sage’ or ‘jnani’ will continue to act in the world as before, participate in the world and ‘see’ the world, but this is the exerience of the ignorant, not the direct experience of the realised Jnani (who is not truly a body-mind entity at all, being just Pure Objectless Consciousness or Spirit, also known as Nirguna Brahman).

See here and here for more on this teaching. Also see the section from Nisargadatta Maharaj below as he explains this too.

Sri Shankara

Now let us see what Sri Shankara says about this – of course we will see that he says exactly the same. Let us first see what he says about prarabdha karma and the jnani. The following verses are taken from his text Aparokshanubhuti, which means ‘unmediated (or direct) experience’. This is an extremely popular and influential traditional Advaita Vedanta text, written by Sri Shankara, that has been used as a manual for teaching Vedanta for over 1400 years, and is a well established part of the Advaita Vedanta tradition:

90. Even when self-knowledge has arisen, prarabdha karma does not cease – so it is said in the scriptures – this [claim] is now being refuted

Shankara first acknowledges this teaching that prarabdha karma continues for the jnani is given in the scriptures. He will now, in the next few verses, refute this teaching, the implication being that it is a lower teaching for the ignorant one, something that is explicitly stated later on in verse 97.

91. Upon the arising of true self-knowledge, prarabdha karma does not exist at all, because the body and all associated things [ie. all other phenomena] do not exist, just as a dream upon waking [no longer appears or exists]

We can see that Shankara is explaining that as the body and all associated things do not exist in genuine self-realisation, how can prarabdha karma exist? Prarabdha needs a body, and if there is no body or any other phenomena, how can there be prarabdha? He then gives the similie of a dream disappearing upon waking, which means that just as a dream ends upon waking, the body-mind-world end upon waking up to Self-Realisation.

In verses 92 and 93 Shankara gives further reasons or arguments why there is no prarabdha karma for the jnani:

92. Karma performed in a previous birth is called prarabdha, but since there is no other birth for the [self-realised] person, that prarabdha does not exist at any time.

Shankara’s argument here is that prarabdha karma comes from previous births. However, for a self-realised person, there have never been any births, ie. ajata (which means no birth or no creation), so how can there be prarabdha karma at any time for a jnani? In fact, there is no time or space for the jnani at all, so how can there be any karma for karma depends on space and time?

93. Just as the dream-body is a superimposition [false projection or illusion], so indeed is this body [physical body in the waking state] too. For something that is superimposed [ie. Illusory or unreal], how can there be birth? And in the absence of birth, how can that [prarabdha karma] exist?

Shankara is here stating in verse 93 of Aparokshanubhuti that the body in the waking state is an illusory projection or superimposition (adhyasa). This implication is that the body is ultimately unreal, having never really been born, and so there can be no prarabdha karma for the unreal.

Now we should be careful here as others interpret this verse slightly differently. They say that this verse merely states that the body continues to appear like a dream for the jnani, but the jnani knows the body, which continues to appear, to be an unreal superimposition on the self. They go on to say that ‘no prarabdha karma’ simply means that the jnani is unaffected by the prarabdha karma which continues to appear but just doesn’t touch the jnani or self. This is clearly a wrong interpretation, for it discounts the previous verse which states the world disappear for the jnani ‘like a dream upon waking’, and the next few verses make it very clear what Shankara’s intended meaning is.

As always, it is important not to cherry pick selected verses but to read the verses in context to understand their true meaning. Let us see the next few verses that make the teaching and intended meaning very clear:

94. Vedanta declares ignorance to be the material cause of the phenomenal world, just as clay is [the material cause] of a pot. When that ignorance is destroyed, where can the world be?

Shankara here is definitively and clearly stating, in classical rhetorical language, that (1) ignorance is the material cause of the world and (2) therefore when ignorance goes, so does the world. In the next two verses Shankara will emphasise this very point so that the meaning cannot be misunderstood:

95. Just as one, by ignoring the rope, one sees a snake due to delusion [ignorance], so too, not knowing the truth, the deluded [ignorant] one perceives the world.

Here we have another definitive statement from Shankara that the world is seen due to delusion, which is a synonym for ignorance. Note that the rope is equated with the worldless self, and the rope is equated with the world, projected and perceived through ignorance.

Doesn’t the jnani still perceive the world, but they perceive the world as self?

Some say that this means that the ignorant one perceives the world as world, whereas the jnani perceives the world as self. However it should be clear that this is not the intended meaning of these verses. If it were, Shankara would clearly say so, but instead he makes it clear that the metaphor to be used here is that of the rope and the snake, and that just as the snake disappears on apprehension of the rope, the world disappears (or, more accurately, the world was seen to have never appeared in the first place); see here in the next verse, verse 96:

96. When the rope is correctly known as the rope, the delusion of the snake does not remain; likewise, when the substratum [ie. self] is known, the phenomenal world vanishes into nothingness

Here we have Shankara stating what he has already stated rhetorically in verse 94.

Now Shankara will explain that the teaching that prarabdha karma continues for the Jnani is merely a lower teaching for the ignorant mind to more easily understand the jnani:

97. Since the body itself belongs to the phenomenal world [which disappears upon self-knowledge], how can prarabdha persist [with self-realisation]? Sruti [the revealed scriptures, ie. Vedas and Upanishads] talks about prarabdha only for the purpose of easy understanding of the ignorant.

Shankara repeatedly states that the relative world only appears due to ignorance

All this world is unreal and proceeds from ignorance, because it is seen only by one afflicted by ignorance
~Sri Shankara, Upadesa Sahasri 17.20

Having thus effaced the triad consisting of dreamless sleep, dream and waking experience, one crosses over the great sea of ignorance. For he is then established in his own Self, void of all attributes of the empirical world, pure, enlightened, and by his very nature liberated.
~Sri Shankara, Upadesa Sahasri 17.58

Because I am without an eye, I have no sight*. As I have no ear either, how could I have hearing*? As I have no voice I can have no speech. As I have no mind, how could I have thought? There cannot be action on the part of that which does not have life force (prana). There cannot be knowership on the part of that which has no mind. Neither can there be knowledge or ignorance on the part of me who am the Light of Pure Consciousness
~Sri Shankara, Upadesa Sahasri 13.1, 13.2

*(Shankara is quoting from Brihadaranyaka Upanishad 3.8.8)

Just as a dream is [apparently] real and valid until one awakens from it, so are the experiences of the waking state, such as identity with the body and the authoritativeness of perception and the other means of knowledge, real and valid until knowledge of the Self
~Sri Shankara, Upadesa Sahasri 11.5

Of me who am ever-liberated, pure, rock-firm and changeless, not subject to modification, immortal, indestructible and so without a body, there is no hunger or thirst or grief or delusion or old age or death. For I am bodiless…
~Sri Shankara, Upadesa Sahasri 13.3-13.4

Shankara’s Vivekachudamani

We also see this same teaching in Shankara’s Vivekachudamani, another extremely important text in Traditional Advaita Vedanta. It is arguably the single most important text historically and traditionally speaking in terms of its influence on Advaita Vedanta tradition for the last 1400 years, and it has been used as a manual of Advaita by countless sages who have also commended its teachings. Sri Ramana translated the entire work (click on link to view the translation) and also wrote an introduction to it which summarises the Advaita Vedanta teachings of Shankara, which you can view here:

460. Prarabdha work can be maintained only so long as one lives identified with the body. But no one admits that the man of realisation ever identifies himself with the body. Hence Prarabdha work should be rejected in his case.

And again, Shankara in his text Vivekachudamani maintains that the notion that the notion of prarabda karma is only taught in the scriptures to ‘convince fools’ who, erroneously thinking the Jnani to be a body-mind entity, ask questions like ‘how does the body of the jnani live?’:

462-3. “If the effects of ignorance are destroyed with their root by knowledge, then how does the body live?” – it is to convince those fools who entertain a doubt like this, that the Shrutis, from a relative standpoint, hypothesise Prarabdha karma, but not for proving the reality of the body etc., of the man of realisation.

ie. Shankara is stating the notion of prarabdha karma is only to satisfy the minds of ‘fools’ and not to show that the jnani actually has a body or sees a world.

This verse is actually very telling, as Shankara’s first point is that ‘the effects of ignorance are destroyed with their root by knowledge’. The effects of ignorance refer to all arising phenomena, including the body and mind and world, also known as duality. The next logical question for a ‘fool’ is ‘how therefore does the body live if there is no perception of a body or a world?’. It is a question for a ‘fool’ as one with a sharper intellect will realise that the teaching is saying that the body and mind are mere projections of ignorance and were never real or existent in the first instance, so this is not something that needs to be worried about or explained.

The ‘fool’, however, attached to the notion that bodies and minds and the world are all real and existent, not realising the import of the teaching, asks the question ‘how does the body live?’.

Now, if Shankara meant by’ the effects of ignorance are destroyed’ that the perception of the world continues for the jnani but the jnani is no longer attached to these perceptions, then the question ‘how does the body live’ does not arise, for the body would just carry on living according to its prarabdha.

So here in this verse, if we analyse it properly, we can see, yet again, what Shankara’s intended teaching is and what it is not.

No duality in non-duality

After these above verses, the text Vivekachudamani by Sri Shankara then goes on to say that there is only the non-dual Brahman, in which there is no duality whatsoever. Repetition is used to drum this point home, ensuring the reader understands there is no change, no activity (karma), it is homogenous (with no variation), it has no parts or aspects to it, etc, etc:

464. There is only Brahman, the One without a second, infinite, without beginning or end, transcendent and changeless; there is no duality whatsoever in It.

465. There is only Brahman, the One without a second, the Essence of Existence, Knowledge and Eternal Bliss, and devoid of activity; there is no duality whatsoever in It.

466. There is only Brahman, the One without a second, which is within all, homogeneous, infinite, endless, and all-pervading; there is no duality whatsoever in It.

467. There is only Brahman, the One without a second, which is neither to be shunned nor taken up nor accepted, and which is without any support, there is no duality whatsoever in It.

468. There is only Brahman, the One without a second, beyond attributes, without parts, subtle, absolute and taintless; there is no duality whatsoever in It.

469. There is only Brahman, the One without a second, whose real nature is incomprehensible, and which is beyond the range of mind and speech; there is no duality whatsoever in It.

470. There is only Brahman, the One without a second, the Reality, the One without a second, the Reality, effulgent, self-existent, pure, intelligent, and unlike anything finite; there is no duality whatsoever in It.

The ego-mind projects the entire world

In Vivekachudamani, Shankara explains that the entire phenomenal world is a projection of the ego-mind or ignorance:

169. There is no Ignorance (Avidya) outside the mind. The mind alone is Avidya (ignorance), the cause of the bondage of transmigration. When that is destroyed, all else is destroyed, and when it is manifested, everything else is manifested.

170. In dreams, when there is no actual contact with the external world, the mind alone creates the whole universe consisting of the experiencer etc. Similarly in the waking state also; there is no difference. Therefore all this (phenomenal universe) is the projection of the mind.

180. Hence sages who have fathomed its secret have designated the mind as Avidya or ignorance, by which alone the universe is moved to and fro, like masses of clouds by the wind.

Some modern readers may think that Shankara is merely speaking of the conceptual world, our ideas or the labelling of concepts and objects, but if you read his writings it becomes clear Shankara is actually stating the the mind literally creates the world. It would take too long to go into this here, but instead you can see this this article here where this is explained in depth – more quotes are given and you will also see teachings from Sri Gaudapada and Sri Suresvara (Shankara’s student) and otheres on this same topic

Swami Chinmayananda

In his commentary on the verse 97 of Shankara’s Aparokshanubhuti, Swami Chinmayananada writes the following:

The BMI, PFT and the OET* together constitute the prapanca [Tom: prapanca, this is the world often used in the scriptures to denote ‘the world’], the ever changing perishable phenomenal world. So where the Reality of the Atman is apprehended, how can the body which is a part of the phenomenal world come to exist? I the dusk you mistook the rope to be the snake and the post for the ghost. When you switch on the torch and then realise the post will you still say that you are seeing the smile of the welcoming ghost in the post, even though you accept that the ghost has disappeared? With the disappearance of the ghost, everything connected with the ghost totally completely comes to an end.

Similarly, as long as I was identifying myself with my body, mind and intellect I recognised my prarabdha and submitted to it. When I realise the Truth, ignorance gets ended and with it the BMI [body-mind-intellect] cease to exist and so how can there be any prarabdha? If this be the case why did the sastra say that prarabdha exists even for a Realised Soul? It is only for the popular understanding of the ignorant who have not got the scientific understanding of Vedanta, at the earlier stage of understanding, that the sastras introduce this in this way. But when the understanding that Truth alone remains, dawns, he will himself come to understand that there can be no prarabdha, for prarabdha is only at the plane of plurality in a concept of time. When a student does not know what a chair is, the teacher draws the picture of a chair and then explains its use and nature. It is only in the initial stages that he draws the picture of the chair and then explains its use to the understanding of the lesser intellects. Later when he refers to the chair he need not draw the picture. So too to the lesser intellects when the sastras explain the nature of realisation with reference to the actions they say there is prarabdha for the Man of Realisation. But, when once the student evolves and gains subtlety of understanding, the teacher points out the Truth in which there is admixture of no otherness.

*Swami Chinmayananda often used these abbreviations: BMI = body-mind-intellect, ie. what I call the body-mind; PFT = perceiver, feeler, thinger, ie. what I call the mind or ego, or what the scriptures call the ego or subtle body; OET = objects, emotions and thoughts, ie. what broadly corresponds to the notion of the world of gross and subtle objects.

I won’t repeat here, but is clear that Swami Chinmayananda is interpreting the text in the same way as I have elucidated above, which in turn is in line with Shankara’s own writings and that of Sri Ramana’s quoted above too.

The next 2 verses of Aparokshanubhuti, verses 98 and 99, continue along the same lines, again arguing against the existence of prarabdha karma for the jnani.

We see the same teaching in Swami Chinmayananda’s commentary on Shankara’s masterpiece Vivekachudamani. Swami Chinmayananda writes in his commentary on Vivekachanudamani verse 462, writing of the Jnani:

‘… For he, in his absolute state of realisation, does not perceive or recognise the existence of the physical body…Summing up his arguments, Shankara, with biting ridicule asks, “How can there be prarabdha for the unreal, which naturally is unborn and, consequently, non-existing?”‘

Notice how Swami Chinmayananda in his above commentary equates ‘unreal’ with ‘non-existing’ and also equates these with ‘non-perception’ and being ‘unborn’. Of course, these terms are synonymous in Vedanta teachings, but later more modern commentators try to twist the words of the scriptures by stating such things as ‘In Vedanta, real means temporary and unreal means permanent’ or other false notions such as ‘Mithya doesn’t mean unreal, it means dependent reality‘. Of course, no such teaching is ever given in Vedanta scriptures or teachings, these being distortions for the mind in order for the mind to make sense of a teaching – more on this in this video and this link here: https://tomdas.com/2024/09/30/the-meaning-of-real-in-advaita-vedanta/

And in his commentary on verse 463 of Shankara’s Vivekachudamani, which we have discussed above already – first here is Swami Chinmayananda’s translation of the verse:

463. If the effects of ignorance are destroyed, root and all, by knowledge, how does the body continue to live? Sruti, from a relative standpoint hypothesises the work of prarabdha for those fools who entertain such doubts

Now let us see the commentary on this verse 463 from Swami Chinmayananda:

In this verse the Acharya tries to explain why even the Upanishads discuss this great concept of prarabdha working upon all bodies including that of the man of Perfection. This is done only from a relative stand-point, to quieten the foolish doubt of an ignorant student.The student sees the body of the Master continuously functioning in the world and naturally, therefore, he feels that the Master continues living because of his prarabdha. Little does he understand that from the lofty panoramic vision of the Master, there is no body, that he is but the pure Self…thus the Upanishads compromise and condescend to accept the concept of prarabdha for the man of realisation only to help the dull ones who are still living in the realms of plurality.

Sri Nisaragadatta Maharaj

Here are some quotes from Sri Nisargadatta Maharaj on Ajata Vada teachings taken from this post here (see this post for even more quotes like this)

The body and mind are only symptoms of ignorance, of misapprehension.

——-

He who knows the state in which there is neither the world nor the thought of it, he is the Supreme Teacher.

——-

What do you know of me, when even my talk with you is in your world only?

——-

NM: The body appears in your mind; in my mind nothing is.
Q: Do you mean to say you are quite unconscious of having a body?
NM: On the contrary, I am conscious of not having a body.
Q: I see you smoking!
NM: Exactly so. You see me smoking. Find out for yourself how did you come to see me smoking, and you will easily realize that it is your ‘I am the body’ state of mind that is responsible for this ‘I see you smoking’ idea.

——-

Nothing dies. The body is just imagined. There is no such thing.

——-

In my world nothing happens

——-

NM: My world is real, while yours is made of dreams
Q: Yet we are talking.
NM: The talk is in your world. In mine – there is eternal silence. My silence sings, my emptiness is full, I lack nothing. You cannot know my world until you are there.

——-

In reality, nothing ever happens.

——-

No doubt imagination is richly creative. Universe within universe are built on it. Yet they are all in space and time, past and future, which just do not exist.

——-

In pure consciousness nothing ever happens

——-

Do understand that what you think to be the world is your own mind

——-

I take my stand where no difference exists, where things are not, nor the minds that create them. There I am at home.

——-

All thinking is in duality. In identity [Tom: ie. self realisation] no thought surives

——-

Now go within, into a state in which you may compare to a state of waking sleep, in which you are aware of yourself, but not of the world. In that state you will know, without the least trace of doubt, that at the root of your being you are free and happy.

——-

To know yourself, turn your attention away from the world and turn it within.

——-

Tom:

There are many other quotes I could give, but hopefully the above gives a flavor of the higher teachings of some of the great sages of the past

As always, all comments are welcome

Namaste

Also see the following posts:

Does the liberated Jnani or Sage see the body, the mind, the world or the 3 states of deep sleep, waking and dream according to Sri Ramana Maharshi and Sri Adi Shankara?

Non-duality, Self-Realisation and the appearance of the world | Sri Sadhu Om

Ramana Maharshi – the 3 levels of the teaching

Sri Ramana Maharshi: Does the world appearance exist after liberation?

The entire path explained: the Path of Sri Ramana (Parts 1 and 2; PDF downloads)

The need to turn within according to Advaita Vedanta | Sri Ramana Maharshi | Upanishads | Shankara | Gaudapada

Shankara: how to Realise the Self (commentary on the Brihadaranyaka Upanishad)

The nature of Liberation | Manonasa by Michael Langford

How can the Jnani (sage) function with NO THOUGHTS? Sri Ramana Maharshi

The nature of Self-Realisation according to Shankara and Gaudapada | Mandukya Upanishad and Karika

Guru’s Grace means inward-vision or introverted mind | Sri Ramana Maharshi | Aham Sphurana

Questioner: I want Bhagavan to bestow his compassionate glance of Grace on me, so that I should undergo Emancipation in this very lifetime.

Bhagavan Sri Ramana Maharshi: Listen to the following joke:

Once upon a time man was fully aware of his Realised nature, and all humans enjoyed Transcendental consciousness while yet in a body; but on one fine morning, Brahma found he had become jealous of them, since all humans were then equal to him in rank, all being Realised gods. So, Brahma decided to take Self-knowledge away from man and hide it where it could never be found by him. Where to hide It was the question. So Brahma called a council of the gods of Heaven, headed by Indra, to help him resolve the matter.

“Let us bury it deep in the earth,” said the gods. But Brahma answered, “No, that will not do, because men will dig into the earth and find it.”

Then the gods said, “Let us sink it in the deepest ocean.” But Brahma said, “No, not there, for they will eventually learn to dive into the ocean, and so will surely find it one day.”

Then the gods said, “Let us take it to the top of the highest mountain and hide it there.” But again Brahma replied, “No, that will not do either, because they will sooner or later climb every mountain and once again find their Immortal Self.

We must hide It so thoroughly from man that he will never succeed in finding It again.” Then the gods gave up and said, “We do not know where to hide it, because it seems that there is no place on earth or under the sea that man will not eventually reach.”

Brahma thought for a long, long, long time. Finally he said, “Here is what we shall do. We will hide It deep in the center of their own being, for men will never think to look for It there.” All the gods agreed that this, in fact, was the perfect hiding place, and the deed was done. Ever since that day, men have been going up and down the earth, digging, diving, climbing, and excavating- searching for something which is already within themselves.

Q.: How cruel of Brahma to do such a thing…!

B.: That was only a joke. The point is, turn inwards and SEE. That is Guru’s Grace. Guru’s Grace means inward-vision or introverted mind. Guru’s Grace and Jnana-dhrishti [Tom: literally knowledge-vision, ie. vision of self-knowledge or experience of self-knowledge] are thus one and the same.

The above excerpt is taken from Aham Sphurana, 30th August 1936, see here for more information on this text.

One who would try to teach something can never be the Sadhguru | Sri Ramana Maharshi | Aham Sphurana

B.: One who would try to teach something can never be the Sadhguru [Tom: the true or genuine or real guru]. He who gives unto the earnest sadhaka suggestion to do this or that can never be the Sadhguru. The sadhaka wants rest from activity – that is why he has come in search of spiritual awakening. He has already become exasperated with ‘doing’, although he might be unable to understand, express or articulate that such is the case with himself. The peace he is searching for so longingly is permanent termination of possibility of activity. In other words he wants everlasting cessation of the madness called ‘doing’.

Instead of being told how to achieve the same, the conned sadhaka finds that the charlatan asks him to do something in addition to, or in place of, his incumbent activities. Could more ‘doing’ possibly be a help to the sadhaka? It will make him lose what little peace of mind he yet had.

Activity stands for creation; creation stands for the destruction of one’s inherent happiness – i.e., the natutal state of poorna.

Reality is perfect happiness only because there is no creation possible in that state. Creation is seen owing to avidya maya. If activity be advocated, the adviser is not a Guru but a heartless tormentor. In such cases we can say that Lord Yama has come in the guise of a Guru, to torture the unsuspecting, gullible sadhaka.

The [evil-minded] charlatan cannot Emancipate; but the one thing he invariably does is this – he strengthens the fetters of those who care to pay any attention to him. You talk of appointing an uttharadikari [Tom: heir or successor] for Ramana Maharshi. Ramana Maharshi has nothing to say; he makes no assertions; he has no message for the world; he has got nothing to convey; he is no teacher; he has no teachings. He IS. That is all. That being the case, where is the question of any successor? The charlatan, therefore, first collects a hefty fee as ‘dhakshina’ and then persuades the unwitting man on the Clapham omnibus to do this and that, saying, ‘If you sincerely do as I tell you, you will obtain peace of mind…’. It is like paying a fortune to purchase poison, thinking it to be amrutham, and drinking it gleefully, congratulating yourself on your ‘rare luck’ at having chanced upon the same. So, the charlatan abets your attempt to kill yourself; obscuring the self-luminous Aathman, which is fathomless Bliss Itself, with upadhis that obnubilate it, and reaffirming for yourself thereby the poisonous, false conviction that your self-identity lies with the perishable body, is certainly an act of attempting suicide. As for Sec. 306, no amount of concealment can permanently veil the Self.

No matter how dense one’s nescience [Tom: ignorance] might be, one casual, merciful glance of Grace from the compassionate Sadhguru, lasting not even for a complete nimisha, will suffice to destroy countless aeons of accumulated ignorance. A mountainsized heap of gunpowder is burnt up by a single spark of fire.

A room might have been in darkness for thousands of years, but when the door is thrown open and sunlight floods in, how long does it take for the room to become totally illumined? Thus, since ignorance is totally vulnerable to being eviscerated by the Sadhguru’s Grace at any time, it cannot be said to have any permanence; so, it is unreal or non-existent…

…The point is, turn inwards and SEE. That is Guru’s Grace. Guru’s Grace means inward-vision or introverted mind. Guru’s Grace and Jnana-dhrishti [Tom: literally, knowledge-vision, ie. seeing the self or self-knowledge] are thus one and the same.

The above excerpt is taken from Aham Sphurana, 30th August 1936, see here for more information on this text.

Tom: compare the above text to Guru Vachaka Kovai verse 271:

271.
The guru who tells his disciple
“Do this or that,” becomes for him
Yama, lord of death, or Brahma,
Lord of birth. He who declares
“You have done enough,” is the true guru
Bringing grace divine.

[The true guru prescribes no discipline, but the enquiry “Who am I?”]

Why has God created the world? | Sri Ramana Maharshi | Aham Sphurana

Questioner: Why has God created the world? I want to know why.

Bhagavan Sri Ramana Maharshi: Did God come and tell you that He has created the world?

Q.: I see creation around me. There must be some reason for creation.

B.: You say “I see.”; if you see that seer, all your doubts will be resolved.

Q.: I do not understand.

B.: Is there anything to be seen in sleep?

Q.: No.

B.: Continue to remain in the state where there is nothing to be seen.

Q.: Should I always be sleeping?

B.: Not seeing anything while remaining AWARE is Realisation. That is God and that is everything.

Q.: Awareness of what?

B.: Being.

The above excerpt is taken from Aham Sphurana, 17th July 1936, see here for more information on this text.

You also are a Jnani; only, you think otherwise! | Sri Ramana Maharshi | Aham Sphurana

Questioner: For Jnanis it is different; what of the common man?

Bhagavan Sri Ramana Maharshi: You also are a Jnani; only, you think otherwise!

Q.: How could that be?

B.: The option of turning inwards and quietly allowing the mind to plunge and dissolve in the Self is equally available for all. It is not the fiefdom of a select few. All are verily only the Self.

Q.: That does not satisfy me. I am unable to Realise it for myself.

B.: So long as worldly attachments are present the mind cannot be succesfully turned inwards.

Q.: How to eliminate worldly attchment?

B.: By turning the mind inwards.

Q.: Really!

B.: The more you hold on to the Self or retain the mind in its native state of subjective-awareness-sustained-effortlessly-and-volitionlessly, the more the mental tendancies and worldly attachments wither off; the lesser the mental tendancies and worldly attachments, the easier does become retention of the mind in its native state of subjective-awareness-sustained-effortlessly-andvolitionlessly.

Q.: Which comes first?

B.: The sadhaka [Tom: seeker] recognises and reflects upon the ephemeral nature of the objective world and the transient nature of his own body. He gets fed up with material pleasures, because they eventually lead only to sorrow, when their enjoyment becomes, for any reason, impossible. He asks himself if a more permanent experience of life might not be possible.

Then he discovers the Ajata-advaita doctrine. Initially he is not convinced, and argues that if it were a dream there would be no possibility of corroboration, but that here his relatives and friends are able to confirm the evidence provided by his senses; he also asks why the same dream should be repeated everyday, were it all only a dream – according to him, here he sees the same sun, moon and earth everyday, whereas in his dreams he finds himself in new worlds moment to moment.

Eventually it dawns upon him that everything he thinks he knows, including an understanding of the apparent permanency of the world he believes himself to live in, is only thought or imagination. Then at the intellectual level he understands the truth – that the names and forms constituting the world are fictitious. This sparks a search for the substratum said to be underlying them, which alone is said to be Real by the wise.

He hears the teaching that the source of the mind, Beingness, is the gateway to the Real Self. Then he begins the practice of quietening the mind by vichara or any other method, tackling various distractions as and when they arise, by withdrawing attention from them and fixing it on Beingness or the Self. The beginning is only becoming fed-up with the evanescent nature of the world and the fugacious attractions it has to offer.

Q.: The boubts Bhagavan mentioned – they are my doubts also. Why is everyone witnessing the same dream? The sun, moon, etc. are seen by all.

B.: In turn those “all” are seen by you only. In deep slumber when there is no mind, nothing is available to be seen, but your existence is a constant.

Q.: Why do I dream the same dream everyday? For instance yesterday I came to the ashram and had darshan of Bhagawan; he was sitting on the same sofa in exactly the same manner. Today I am seeing Bhagawan and tomorrow also it is going to be the same Bhagawan.

B.: The future is a mere mental projection. The past is a mere memory. Have you not had dreams where the places you visit look extremely familiar?

Q.: At least is the present real?

B.: Anything seen cannot be Real. What is seen is not Pratyaksha. It is not self-evident, because there is a subject-object relationship involved. It is merely sensory information that is fed into the mind by the strength of its own evil faculty of avidya maya. That alone is Real which shines by its own light.
You are asking about the objects of the world. Can such objects exist without a YOU, a perceiver? When there is no perceiver, as in swoon or deep slumber, is there anything to be perceived? No. What is the inference? The objects owe the appearance of their apparent existence to you only. They are merely mental creations. The appearance of this enormous cosmos around you is merely a mental information. The mind is fiction. Therefore the ‘objects’ manufactured by it are also fictitious. Have not the least doubt about it.

Q.: If everything is unreal, can we conclude that bondage and liberation are also unreal?

B.: Yes.

Q.: Then why should I try to obtain Liberation? Let me remain as I am.

B.: Exactly!

Q.: I do not understand.

B.: Remaining as you are is the loftiest Sadhana.

Q.: How can remaining in ignorance be sadhana?

B.: You think that you are in ignorance. When you do not think at all, what remains is only wisdom. Removal of the screen of thought is all that is required for Reality to be revealed. Since you want a sadhana by means of which you may reach this thought-free state, vichara is suggested. Actually there is no need for any sadhana for one who has mastered the art of remaining as he is – the art of Being. That is the import of the advice Summa Iru. People generally misunderstand it. It does not mean keeping the body idle. It means keeping the mind still or free from thought. Remain perpetually absorbed in the thought-free I-Current. This will automatically lead you to the Sahaja-stithi [Tom: the natural state] without requirement for further effort.

Q.: Is even desire for Liberation an obstacle to Liberation?

B.: Yes.

The above excerpt is taken from Aham Sphurana, 17th July 1936, see here for more information on this text.

The sage liberated in this life (Jnani or Jivanmukta) is not a body-mind entity

This was first posted on Facebook here

If you take the Jnani (liberated sage) to be a body-mind entity, then you will think he or she eats, drinks, talks, thinks, feels, acts, does this, does that, etc.

But the Jnani is only pure objectless consciousness, one without a second, the pure true non-dual self. The Jnani has no body or mind, and sees no body or mind or world, all of which are seen by the fictional ego due to ignorance, and are known as duality.*

Metaphorically speaking, the Jnani only sees his own (formless, objectless, worldless, homogeneous) Self.

The false I, or ego, rises up, and it is this false I that experiences and perceives all gross and subtle phenomena.

Turning back towards Source/Subject/Self/I Am, with love, in silence, dissolve into that which you truly are.

This is the only way to discover the truth of yourself, and thereby end ignorance delusion ego and suffering. Anything less than this will not end suffering/confusion/delusion/duality.**

🙏🙏🙏

☀️☀️☀️

*This is why Sri Ramana Himself wrote the following verse from Guru Vachaka Kovai:

The sage Self-realised knows not
Whether the transient body comes
And stays, or dies and leaves
, even as
The senseless drunkard knows not what
Happens to his clothes.
~ SRI BHAGAVAN 24

This is also the true meaning of the Upanishadic verse, a form of which is here written by Sri Ramana, also in Guru Vachaka Kovai:

There is no creation, no destruction.
None bound, none seeking, striving,
Gaining freedom. Know that this
Is the Truth supreme.
~ SRI BHAGAVAN 28

A version of this above verse is found in the Amritabindu Upanishad in verse 10 and in the Atma Upanishad in verse 2.31. It was later incorporated by both Gaudapada (Mandukya Karika 2.32) and Shankara (Vivekachudamani verse 574) in their writings

**This is why Sri Ramana says in Guru Vachaka Kovai:

291. For those who seek eternal life
The assurance stands: the senses five
Retracted tortoise-like, the mind
Turned homeward to the Self
and there
Abiding is pure bliss.

293. Know that these countless things are pictures
In a dream and none is real
Apart from the beholder. Shun
This phantom world of names and forms
And dwell in the pure, blissful being

Of Awareness.

364. When the ego-life dissolves
And dies in silence
, then one lives
The life supreme of Pure Awareness.
When the false ego dream-like fades
Into its source
, the true Self rises
Of its own accord.